DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and apolpp

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:NP_001259085.1 Gene:apolpp FlyBaseID:FBgn0087002 Length:3351 Species:Drosophila melanogaster

Alignment Length:4579 Identity:851/4580 (19%)
Similarity:1523/4580 (33%) Gaps:1564/4580 (34%)


  Fly     8 AAIWLLLLIAHTQAVR-ENPLKDPRICGRPQCDSKSAKF---NYGEQLYKYQY----TVAVRTEF 64
            |.|.:|..:..|.||. ||...    .|.|:.|:...|:   ||    |.|.:    |:...::.
  Fly     9 ALIGILASVLLTIAVNAENACN----LGCPKSDNGLLKYIPGNY----YDYSFDSILTIGASSDV 65

  Fly    65 AGSGDNSSDLLLKSDLEIFFPKPCEGYLRINDAKLYDTLDELNDNESDSSEKTKEYDYYDNLANE 129
            ....|::| |.:....:||....|...|:::..|:.:|.:.:.....:|.:|.            
  Fly    66 PNDSDDTS-LKVSGSAKIFAKGNCGYTLQLSSVKVTNTKESVEKKILNSIQKP------------ 117

  Fly   130 ESESQNYDNMHPKSSDFNVDLTKNLLRFAFHDGLIS-EVCPQEQETPWVLNIKKGILSAFQNTMM 193
                                     ::|....|::. ::|....:..:.||||:.::|..|:   
  Fly   118 -------------------------VQFTLVSGILEPQICSDSSDLDYSLNIKRAVVSLLQS--- 154

  Fly   194 RFDVDANTTETDVSGQCQVQYALEDTDSSYVTIRKTKDINSCRQRYATHSVLQTTPYTFRDDKTI 258
              .::|. .|.||.|.|....:.....::.: |.|.:::|||..|...:|.|.:.....:...|.
  Fly   155 --GIEAE-HEVDVFGMCPTHTSTSKVGNANI-ITKARNLNSCSHREQINSGLVSGKVNEKAGITS 215

  Fly   259 WPILKSQSHCNLTIDNNVYKEIKCLETHLLVPFSNASSGALTTSTSRLKL---DGVESYSAG--- 317
            ..:|::.......|.|::.:.::..||:..:..:..:|.......:.|||   .|.::.|.|   
  Fly   216 SLLLQANYIKESRIVNHLIENVQLTETYKFIGNTKRNSDISAKVVTILKLKNPSGTKANSPGTGS 280

  Fly   318 ---EFLEQNPELVERRATLVFDHTPAVKPSHDEIKAARELLVEMCRVGFPNIQREFIDVFTNFLQ 379
               ..:.|.||....:                .|.|.:.:|.::.......:::|....|..|::
  Fly   281 TVRSLIFQRPETYTSK----------------NINALKTILSDLVDSTGDYVKKETAKKFVEFIR 329

  Fly   380 TSKSLDYKTLSVLLQRSASTCEQGRNHLLESLPFIGSTA-SYKVMRDQI--INEKLTKQMAHDWM 441
            ..:..|.:||..|...........|...|:.| |..||| |.:|:..|:  .:|| .|.:|   :
  Fly   330 LLRQSDSETLLELAAFPHPNKVLARKVYLDGL-FRTSTAESARVILKQLSKFDEK-EKLLA---I 389

  Fly   442 TALSFITRPDEETLETFHS--------ILEYAKNRLDAEYTLGATAVVHSFCKHHEACEENLRVQ 498
            .:|:.:...|:|||....|        .|..|...|.|:|.|      .::|:..|         
  Fly   390 LSLNIVKSVDKETLNQAASQLLPNAPKELYIAVGNLVAKYCL------KNYCQGPE--------- 439

  Fly   499 QIINLLETEFLN-LYNLFKGERRTRERMVILLKGLGNIGVVSSAFAEQLQWIIREDEAPVDIRLH 562
              |:.:..:|.: |.:.....:|..||:|.:||||||...:|......|........:. .||:.
  Fly   440 --IDAISKKFSDGLKHCKPNTKREEERIVYILKGLGNAKSLSGNTVAALSECASTGRSN-RIRVA 501

  Fly   563 GILAFRRVDCARH-RSYFLDNYGNYTLNSELRIYSYLQAMRCPDYISVGVIKSILEHEEINQVGS 626
            .:.||.:|.|... :|..|:...|...:|||||.:||.|:.||:......|..|:..|.:||||.
  Fly   502 ALHAFSKVKCEETLQSKSLELLKNRNEDSELRIEAYLSAISCPNAEVANQISEIVNSETVNQVGG 566

  Fly   627 FVWSHLTNLAKSNSPVRIEAQGLLLNDELSERFKMDIRKFSRNYEHSLFFDEYNFGTTTDANVIF 691
            |:.|:|..:..|....|.:.:..|.|..:::.|.:|.|::|.|.|.|...:....|.:||..:|:
  Fly   567 FISSNLKAIRDSTDVSRDQQKYHLANIRVTKTFPVDYRRYSFNNEVSYKLESLGVGASTDYQIIY 631

  Fly   692 GTDSYLPRIASVNFTADLFGQSVNFFEFTARAEGLEELAANAFGPKGPLSGQLLRKKLSFLNRWL 756
            ....:|||.:.:|.|.:.||.:.|.||.:.|.|.:|::.....||||     |:.|         
  Fly   632 SQHGFLPRSSRINVTTEFFGTNYNVFEASVRQENVEDVLEYYLGPKG-----LVNK--------- 682

  Fly   757 GNESAEEDDTLENLLSLDNLRLKRKAQEQARASEEEVDEDYDFEESLEGNKRQKRDVSTTRKQEI 821
                  :.|.:..|:.:.|    .......||....||                 |||     :|
  Fly   683 ------DFDEIVKLIEVGN----NGVAAGGRARRSIVD-----------------DVS-----KI 715

  Fly   822 DRNVDSLGYKLKYDYNNPRAQFGLRVFGNDLRYFNV-----ESLVEVMALAAKFNPFQQAKNVLS 881
            .:.....|.|...|.|   ....|::||::|.:.::     .||.:::...:  ..|::||..||
  Fly   716 SKKYKMYGVKNVQDLN---LDVSLKLFGSELAFLSLGDNIPSSLDDIINYFS--TSFEKAKQELS 775

  Fly   882 GKEFTYTKSRVFLDASYTVPLAVGLPLAIHA--FGASSIDLRVSGNLDEMDPPTDWHFDVEGQFK 944
            ..|..::...:|||.....|.::|:||.:.|  |.|:.:||.||.:::.:............:|.
  Fly   776 SFEKQFSSHHLFLDTDLAYPTSIGVPLELVAQGFAATKVDLAVSLDINAILEQNWQKAKYRLKFV 840

  Fly   945 PSVSVDVITTMQTDMFWEQSGIKVKSNLYS--NSELVAKLKVRGRNLVSFSFDLPRDKNEI--FS 1005
            |||.::....:..:.....:|::|.|:.:|  .|::...:...|... :...:|||:|.|:  |:
  Fly   841 PSVDINANVQIGFNAQVLSTGLRVVSSAHSATGSDITVAVISDGEGF-NVDLELPREKLELINFN 904

  Fly  1006 VRSELLVQKREEQLPQAGIAN-RSANSTCTWPVLDQ--AIGLQMC--SHYSVPDL----SNATE- 1060
            |.:||.|.::::|...|...| ::.||..:....:|  .:||.:|  |..|:.::    .|..| 
  Fly   905 VDTELYVAEQDKQKAIALKGNKKNKNSQPSEICFNQLELVGLNICIKSSTSLSEVQAGNGNVAER 969

  Fly  1061 ---IYPSLLLAGPLNFSLILKKSDLSAKKYVFEYKWDQQEEDNNFSLVFTTPGSKVPR--VLVAN 1120
               :.....|:.|.||::.|    .:.:|:.|:....|:.....:.|.::||||||..  .:|..
  Fly   970 GLSVSEKFHLSRPFNFAVYL----TTERKFTFKGIHTQEAFSQKWKLDYSTPGSKVSHDTTVVYE 1030

  Fly  1121 VTKVPDAF------NASVAFV------NGPNRVSAGCSYDGNPDFRRLDIYLDTNGNRSLDLGME 1173
            :...|..|      |:...|.      |..|.:.....|:.:.:.::..|....|||.       
  Fly  1031 LGNKPKTFSRLSFDNSQCHFAVEGGINNDKNELVVYGQYEQDKEIKKSKIGFSKNGNE------- 1088

  Fly  1174 LRRHQDFTAWIYNPRMLLAINGVNITGLAGTVKVNEKNGIKQHDVDLSFETKKLQAVIKGNVVQS 1238
                       |.|                .:::.:.|||...              |.|.....
  Fly  1089 -----------YKP----------------LIEIQDNNGISNS--------------INGYHADG 1112

  Fly  1239 EITTSTNMTIKYRFQANKIEEINFAGKLVNNGDKSKTEYRGNMKLQTSAYPKLNFASESTWLSLQ 1303
            :|....|        :|.||..||....|:|.:.:.....|                   |..: 
  Fly  1113 KIVVKKN--------SNNIERYNFENFQVSNSNNAHVAVNG-------------------WSDV- 1149

  Fly  1304 GHTEGMITYNNAPDYVNPNYTSLVRLIFARSHSEDSFLDGTQTRASLELKLPRSKIDYR-ILVKH 1367
                                                   ||.:..| ||::   .:|:: .|:|.
  Fly  1150 ---------------------------------------GTNSLTS-ELRI---SLDHQTFLIKE 1171

  Fly  1368 KEHIKNGT-EHNVIVGLKYTPEKEITGLFSVHLPRRNLFAIDAYMNVTVPEFNSCTASLKVNEKA 1431
            ...::||. |....:..:::||              |::....::.:....:     :||.|.||
  Fly  1172 NLKLENGLYEAGFFINDEHSPE--------------NIYGSSIHLTIADQSY-----ALKTNGKA 1217

  Fly  1432 TKDYIIFINGSWFTGHSVAVKANYKDRSSRVQALHHLKMIVESPSFNITSL----NIIYRRKQL- 1491
                     .:|..|         .|.|...|.|      .:|.|....||    .|.|:.||: 
  Fly  1218 ---------AAWSIG---------SDGSFNFQKL------ADSNSARAGSLVENVEIQYKNKQVG 1258

  Fly  1492 -----------LIFYDIQAKYDQDPYGLTIQYASN-AHNRNTNAEVRLKVKERD----------- 1533
                       .:..|::...:|....:.::|.|| .|.::.:.|...|:.:..           
  Fly  1259 GIKIMSNFDVNKMDVDVEISREQKIGSIIVKYESNQRHAQDYSLEASAKINKHSIDVISKCDFNG 1323

  Fly  1534 --YWINAKLLSEQPKLLQLEIHMDK---IRDVHIQV-GLLNV---DKRKELSLEL---------K 1580
              |.::..|::....||..:..:.:   .:|::|.: |.:.:   ||..:..|::         .
  Fly  1324 NVYVVDNSLVTSWGTLLSAKGEIGQRYSAQDININIQGNVQISGKDKVTQWILKVIGTPDKTNSD 1388

  Fly  1581 WDANRDPSQRLGLLAEYNSPGTKHYDGNLMITYPE--------RTIHFGFNSFTGG-------PK 1630
            :..:||.|:.:.|.:|...|..|.....|.:....        |....|...||..       ||
  Fly  1389 FRISRDTSELIKLTSESQHPQDKISFAKLNLIVKNQLTAKGEFRVAKNGKGDFTASIDTLKTEPK 1453

  Fly  1631 YFGKVHASWSINEVIEFEYEAGILPGHTLHNWVKAELRTPFDGWRVNSLDAGIYSLKNLILVNST 1695
            :..::.:.:.|... :::.:|.:    ||....|..|::                 :|.|     
  Fly  1454 HKLEIESKFHIQSP-KYDIDASL----TLDGKRKVHLKS-----------------ENTI----- 1491

  Fly  1696 LFWADDQKLQVGYKSDYDVNDQLMSFDVRFGINSTIRDIPTINVKVKHWMDVKKVDTELYLGYSG 1760
                  :||:...|:..:.||::::|:....:...:|                           |
  Fly  1492 ------EKLKFSTKNIGEANDKIIAFEANGSLKGELR---------------------------G 1523

  Fly  1761 QNDTFNTYSMDSSWEIEKNQRYNNYSGLVHLVSPFKGYEKGGLVAHFSLSDQRVVSGAASLNFDL 1825
            ..:...|:.                                     |:..|.||:.|  |:|   
  Fly  1524 NGEIQGTFI-------------------------------------FNAPDGRVIDG--SIN--- 1546

  Fly  1826 REFTLTMNGYVKKFTDNMLTVNITTPLEKFGTINARFGLNEKKRHAVAEVRAPTAALGVEVLADI 1890
                                       .|..| ||:.||::.                       
  Fly  1547 ---------------------------RKIST-NAKSGLSQG----------------------- 1560

  Fly  1891 KNLLNFDVKLSVATPIESFQQAAIFALFNPERVDMRGLWNNVTLGFTGVWHMQNITDFEYSYHVF 1955
                |.|.:|| .||..|.::.:|..:...:|::                               
  Fly  1561 ----NIDAQLS-DTPFGSNKKRSISLIGKLDRLN------------------------------- 1589

  Fly  1956 TPLAGFEENGFIVQLLKRKEFVFQLHGKMSNYKLGVKINGEPKSDLVNQLGSNKMELEMLYDADF 2020
                           .|.|||      ..::..:....||| ||::..|:               
  Fly  1590 ---------------TKTKEF------SANSNLVYTAFNGE-KSEISYQI--------------- 1617

  Fly  2021 KPLNAETDYKPDADEEYFSYFTNFQVDTLVWPTIVGNVDIQEIIDFYLVVGHVELPQGKVEFKDR 2085
                   ..:|:.|.:.                          |||.|......|||        
  Fly  1618 -------KQQPNGDAKN--------------------------IDFSLKAYGNPLPQ-------- 1641

  Fly  2086 LHYPDYINVHNLLTVTTPFAVAKNIKSIVEYHVDLNFNAFYERVKFIVNDDKDNTQELGFVFNYT 2150
                             ||.:|                       |.:.|             |:
  Fly  1642 -----------------PFEIA-----------------------FALGD-------------YS 1653

  Fly  2151 ALQDNVKPKAHDVQVTLLTPYEMLHEIYVHGHIELDDNAYKGNISAVTAHTHLSMAASIENEDNF 2215
            |        .|.| |::.:.|                    |.|.:|:|:.:.       |.:..
  Fly  1654 A--------QHAV-VSITSKY--------------------GEIFSVSANGNY-------NNNQA 1682

  Fly  2216 LETSVGIQLETDAIPHYGCQVYFKKDFSAVDKAIDIRFEVTDNGTLNQLHISTDWHTDPSYIVNA 2280
            ||              ||.|.               ..|: ...||..|.|            |:
  Fly  1683 LE--------------YGLQA---------------NIEI-PKSTLKSLEI------------NS 1705

  Fly  2281 NGRIKTTMLPLQMASTSVLVIQGQNPHLNFDLNLLSQNGQSIAYGARANKKKDVFNIEVWTPMKN 2345
            :|::..::            |..:|...|.:..|.|:.  |:...||.|        .||     
  Fly  1706 HGKVLKSL------------IGNENAAYNVEFFLDSKT--SLGQYARVN--------TVW----- 1743

  Fly  2346 FRNISMHGTAIRSPRDPGRYDVSGFLYRNMATYEVTGAVRMTNSL--PIDVVLRVQPKAGG--RD 2406
                  :|||     :.|.||...                .||::  |:....:...|..|  :|
  Fly  1744 ------NGTA-----NDGSYDFEA----------------QTNNMESPLKFNGKYHRKQTGNIKD 1781

  Fly  2407 GVIE------LNIHEAGPKKIRFSFSAIEDGKMCQMSGGYSVSKTNGAMDFSVLVESTEPEI--A 2463
            |.:.      ||. :.|.:.::...|.           ||...|    :|.:.:::|:...:  .
  Fly  1782 GDLTGKQTYVLNA-QYGAQYVKMDASL-----------GYGAEK----VDIAYVIDSSFDSVKDI 1830

  Fly  2464 RINFYGNLSPNSEGSLVGDLSLETPWKALGIDTVHLHSDVGFLNKGGHIVGEYKIGQYIGRGSCL 2528
            ::|. ....|..:.:.|.....:...|:.|:||...||             .:|.|         
  Fly  1831 KVNI-RTFKPLDDSTYVVTALFKQTDKSYGLDTTFYHS-------------AHKKG--------- 1872

  Fly  2529 WSWILAEDMQLVLENYLERPNAKPRIVHASAKY--QNPGQTFTQLQAGGRLSVDSKWNLDVNGSA 2591
                        ::..|:....||.|:.:.|:.  ...|:...::     |:: :..::.:|..|
  Fly  1873 ------------VDIRLDLLKEKPIIISSIAELLGDRKGKVLFEI-----LNL-ADLDIKINSEA 1919

  Fly  2592 EYKSVDDFKFRVITALPLPVGDRHQLSASYQGNVISQQFNNPDFVLEASYESFEAQNKLLSRISY 2656
            .|.|:|:|...|..:......|.::|.|..|...|..|..|.:.::.:...::..:.:|...|  
  Fly  1920 SYVSIDEFYIIVNWSSKKLKLDGYELEARAQSKNIKIQLKNENGIIFSGTATYALKKELNKTI-- 1982

  Fly  2657 KNATNNLKGLGHVEW-GKIQNLSVVEGDFELLHKQ---GAQRE--FSAKIITPKFKNEHTFALTG 2715
                  :.|.|.|:: ||     .:.|:|:|..:.   |..||  ||           :||    
  Fly  1983 ------IDGQGKVQYQGK-----ALSGNFKLTRQHFDFGTDREVGFS-----------YTF---- 2021

  Fly  2716 SYDLEKSGHHNVVGSLDY------------PASRRITDLDV-SVSSLSNMHGIFNSTLPTFLNVS 2767
               :...|..|.:|:|..            ...|:.|:|.| |:.|:....  .::...|.|.:.
  Fly  2022 ---MGNLGSKNGLGTLKITNKEFNTKFSVCEEKRQCTNLIVQSIVSIDEQK--LDAVEHTTLIIV 2081

  Fly  2768 WLKTDFNF---------TTNNGKSYRYCRCFWPQDTAYFKLNSNYDS---DSSNFNHNLNGNVEI 2820
            .|: ||.:         .|..|..|:|                :.||   ..:||.:....||: 
  Fly  2082 DLR-DFGYPYEFELKSQNTRQGLKYQY----------------HLDSFIITGNNFKYQFTANVQ- 2128

  Fly  2821 EVPLATRHRADIVYGLQKRRNQDAGNVKVVYNEKQVLDGKYKRLEQAKAPIYKETTDISLENEVK 2885
                                 ..:..:|:...::|:|                            
  Fly  2129 ---------------------PTSSTIKLALPKRQIL---------------------------- 2144

  Fly  2886 PLGIHFVSTRDASDPAGSQDVKHIEIYELRNTQNFNLTGELHSRATLKAQDFKVVAIHPNRAVVL 2950
                                        ...||.....|.|..|                     
  Fly  2145 ----------------------------FETTQKIPADGSLFGR--------------------- 2160

  Fly  2951 STKYEDVSPEVVRHHSKLELSETAWIGYNLELGNFSKV----GNESQSFALEIFYPKRNLSSSGQ 3011
               ||..:...:   .||:..:        ::..||.:    |.|..:|                
  Fly  2161 ---YEQTASFFI---DKLQKPD--------DVARFSAIVDVTGTERVAF---------------- 2195

  Fly  3012 YYMTDTNFNSDLSFQWLGGNYDQQPKIIHSNLQWKAEPLHRGDREHRTIALTVAHPLLEKDINCK 3076
                  |.|..|.|                              ||.||........|..|:|  
  Fly  2196 ------NANGKLKF------------------------------EHPTIRPLSISGQLNGDVN-- 2222

  Fly  3077 ATYYRGLRDLLRTHLTIDYSEYPDQLIELGAQLTDRYSELGHTNYTFHVYGKHIASELDVQLNGT 3141
                   :.:....:..|....|:|.:...::|.:..|:.|. |..:....|....:...|:|..
  Fly  2223 -------QQIASAEVIFDIFRLPEQKVVGNSELRNSRSQNGF-NIAYITTVKSAGLQFQYQINSN 2279

  Fly  3142 LAAMNSYYKTESTAHYKRDIFPARYGKFLAL----LDV------NKRELEYERQSPFHAVRLHLL 3196
            .|.               ||....|...|.|    :||      ||.:.|           :.|.
  Fly  2280 AAV---------------DIEAHEYNIGLELNNGEIDVKAISFLNKEKFE-----------ISLS 2318

  Fly  3197 PTIRYPIYGLNATIWDTPDTNHSGYIYMDILERYARMDFN---LTEDASQN-----LQMVGYIPD 3253
            .:.::.||    .:.|....||    |..:..:...:|.|   :|.:...|     |:...:|..
  Fly  2319 ESNKHIIY----IVGDFSKQNH----YAKLNTKVQILDKNPIEITSEVQPNSAKIILKRQDFIDG 2375

  Fly  3254 TRSAFL------DIWRNYEEI---RV-IDVSSYLKMNH---SRLITGRFHWRPSIRQEVREKIQA 3305
            |....|      |:..:.:::   || :|.:::|:.|:   ...:.|.:|               
  Fly  2376 TAEVKLGKEFKVDVIGSGKQLFNGRVALDATNFLQTNYFINEDHLNGFWH--------------- 2425

  Fly  3306 VGKSVYSSFSEGIDFWIKSIYTETTESMGVVWNTAKEYNRDFIDDIGQLSVLEEDLADLRLFVNQ 3370
            :.:|..:..||.|...||....::.:....:...|||...||       |.|:..|.|.:..:.|
  Fly  2426 IVESEINKDSEYISENIKERLKKSRQVTDKIVKLAKEAGPDF-------SKLQGKLLDYKNDIVQ 2483

  Fly  3371 SYEANDFYIKNVVNFTLTILDELAIRDHIESLPKIFSELWQAMGDSGKALRNSIVWLIETIKTTY 3435
            ..|| |..|..:::...|:..::|  ..::.:.|..||:.:      || :.|||.:.:.::..:
  Fly  2484 ELEA-DQSIAPIIDGIRTLFKKIA--GIVDDINKAISEILE------KA-QKSIVDIYDKLQALW 2538

  Fly  3436 -NNLLDAVARFFHGESLVYISGLLEKGIAKYDSFIKDLHIKFIKYIENLWHKTWTLAENHWKAVL 3499
             ::||.|...|                |......|..|..:|||.....:....:..|.:..| |
  Fly  2539 KDSLLKAWEDF----------------IITVQKLISTLKTEFIKICTQSFKDLLSALEKYGPA-L 2586

  Fly  3500 KRFEPHLFKMISFIETTAWNLSKEVFDFIYKRTNELAESPYFNKVSSFTADAERLYRDFKANDAI 3564
            |.:...:.:::..|...|..:.|.|.:.....|:|..:  |...:.||    |.:..:|  ||.:
  Fly  2587 KNYGKAIGEIVKPINDAAQEVIKIVVNAAEGVTHEFKQ--YVASLPSF----ESIRNEF--NDKV 2643

  Fly  3565 TNIKKY--STIAWNFVKEKYFKLVPFGAELNEVLTEIWQEIKELEKIDQVQIMVQKYYEVMAKV- 3626
            ..:|.:  :|...|.:.:: ..::|...|.:|.|.::...:  :.|:.|..|..:||.|.:.:: 
  Fly  2644 KVLKLFEKATELTNSLFDQ-INILPQTPETSEFLQKLHDYL--IAKLKQEHIDNEKYIEELGQLL 2705

  Fly  3627 ------DWVADELQLEHRLHQVY--------------GLVRNKFRNYAMNALETADMYREAKTKF 3671
                  .||:        :...|              |.:.:.|.:.|:  |.:...:|.:....
  Fly  2706 IKAVRSIWVS--------IRSTYPGSSDHVIDFQSWIGSLTHSFDSLAV--LPSILSFRSSILNC 2760

  Fly  3672 VFDPEVGIIDLEQKLPMSWHAFNETPRFEEIPEYQVLAKAQSFFSETNSSIVMKLYNMRTHLDPK 3736
            :.:....:: ..:||..||..||:                               :.:|.|    
  Fly  2761 LLNENWDVV-FNKKLLYSWIFFND-------------------------------FELRGH---- 2789

  Fly  3737 TWLPPYYSRALLIDSRHYMTFDQRYVGLNLNFDELGNGRSTSQCSYLLAHDFFKRNFTLLLEPAS 3801
                       ::|.:|..|||      .|||...||      |.|:||.|....|||::     
  Fly  2790 -----------VVDGKHIFTFD------GLNFAYPGN------CKYILAQDSVDNNFTII----- 2826

  Fly  3802 KSLAGQGLTRKLSFIA----NGQLIEIDLETDHIS--INGN----PQPILPLKLGDVNIHRDLDV 3856
                ||....||..|.    .|...|:   .|:::  :|||    ||     .|..::..|....
  Fly  2827 ----GQLTNGKLKSITLIDREGSYFEV---ADNLALKLNGNLVEYPQ-----HLSGLHAWRRFYT 2879

  Fly  3857 LSITSDTEFSLHCNVQFDLCWFEVSGWYFGRTAGLLGTLNNEPYDEYTMSSGVISNETQLFTDSW 3921
            :.:.|:....:.|.....:|...::|:|..:|.||||..|.||||::.:..|.::..:....:.:
  Fly  2880 IHLYSEYGVGIVCTSDLKVCHININGFYTSKTRGLLGNGNAEPYDDFLLIDGTLAENSAALGNDY 2944

  Fly  3922 SLKQCRQNKLAQTQEVSQEVSDACTSFFRTGILATCS---AVLDPTPFYEMCMDLGMKSPPIRKG 3983
            .:.:|...:....|..|.:..:.|:..|  ||.:|.:   ..||..|:.:.| |:.:.....::.
  Fly  2945 GVGKCTAIEFDNNQFKSSKRQEMCSELF--GIESTLAFNFITLDSRPYRKAC-DIALAKVAEKEK 3006

  Fly  3984 HPAVKGACAAALAYIEACTALKVPMRVPSQCVFCQLSNGSYVPEGTFMELSGPEIPKSS-DVVFI 4047
            ...   ||..||||..|...:...:.:|.:|:.|....|.:    .|.:....::|.:. ||||:
  Fly  3007 EAT---ACTFALAYGSAVKQINKWVLLPPRCIKCAGPAGQH----DFGDEFTVKLPNNKVDVVFV 3064

  Fly  4048 VEAKECNANLKTSKNIMTVVSSIEEQLQAAKITNNRYAVVAFGGVSPYDKARSVIYEHNEFTSKP 4112
            |:.......|  |..|...::.|.|.|::...::.:..|:.|.....|                |
  Fly  3065 VDINVTPGVL--SNLIAPAINDIRESLRSRGFSDVQVGVIVFEETKRY----------------P 3111

  Fly  4113 EQLADYFGHIN-TGN------------------------------GSSNDILMAIS--------- 4137
            ..|....|.|| .||                              .|..:|:..|:         
  Fly  3112 ALLTSDGGKINYKGNVADVKLAGIKSFCDNCVEQIITEKRILDIYNSLKEIVKGIAPQADEKAFQ 3176

  Fly  4138 AAAKLNFRPGVSKTFILLSCSKCAARD----MRFDYT-SILQYLLEEGVNLHILADTE---FDFE 4194
            .|....||.|.:|:.|.:.......::    :|...| ||.::   :|..:|::|..:   .:..
  Fly  3177 LALDYPFRAGAAKSIIGVRSDSLEYKNWWKFVRAQLTGSITKF---DGALIHLIAPVKGLSLEGV 3238

  Fly  4195 RNKKLRHFFGLDSKLVYSKRFPEGDAETRNTTHIPKSNLGICTTLAVETQGSVFSARKLQPERKY 4259
            .::||   .|.:|:||.:   .:|....:.|.....:::||  ...:...|.||:.:..:..:..
  Fly  3239 LSEKL---IGFNSRLVAT---VDGKDSKKRTKLQFDNDMGI--DFVLNNGGWVFATQNFEKLKAS 3295

  Fly  4260 PIKRFATIFAKRVA--LSATPIQSQTCEC 4286
            ..|:........:|  |..|.|.|. |.|
  Fly  3296 DQKKMLNQITSSLADTLFKTEIVSD-CRC 3323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 135/611 (22%)
DUF1943 665..1012 CDD:286281 87/358 (24%)
DUF1081 1029..1122 CDD:283982 26/107 (24%)
VWD 3741..3908 CDD:295339 48/177 (27%)
C8 3951..4014 CDD:285899 16/66 (24%)
apolppNP_001259085.1 Vitellogenin_N 43..573 CDD:279663 137/618 (22%)
DUF1943 605..911 CDD:286281 87/358 (24%)
DUF1081 932..1031 CDD:283982 24/103 (23%)
VWD 2789..2931 CDD:214566 49/186 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C368153061
eggNOG 1 0.900 E1_KOG4338
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 1 Normalized mean entropy S10273
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0008740
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23345
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7740
65.910

Return to query results.
Submit another query.