DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and cv-d

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:NP_732076.1 Gene:cv-d FlyBaseID:FBgn0265048 Length:1470 Species:Drosophila melanogaster

Alignment Length:1656 Identity:308/1657 (19%)
Similarity:563/1657 (34%) Gaps:533/1657 (32%)


  Fly    49 EQLYKYQYTVAVRTEFAGSGDNS---------SDLLLKSDLEIFFPKPCEGYLRINDAKLYDTLD 104
            :.||:|:..|.|..:....|..:         ..|.|:...|:..    ...|.|:|..|     
  Fly    30 QMLYEYEGNVLVGAKPQDEGHQAPPTTGWIVRGKLTLQRQSELVL----AAALVIDDVTL----- 85

  Fly   105 ELNDNESDSSEKTKEYDYYDNLANEESESQNYDNMHPKSSDFNVDLTKNLLRFAFHDGLISEVCP 169
                  ::|.||.        |.|:|        |:|....|.:.|||        ||.||.|..
  Fly    86 ------NNSGEKF--------LQNKE--------MYPPYKPFKIALTK--------DGAISHVVF 120

  Fly   170 QEQETPWVLNIKKGILSAFQNTMM---RFDVDANTTETDVSGQCQVQYALEDTDSSYVTIRKTKD 231
            :|.:..|.:|.|:.|.|..|..|.   .|.||    |..:.|.|:.:|.:.:. ::|::||||.:
  Fly   121 KEGDPIWSMNFKRAIASVLQFQMKSSGAFVVD----ELGIHGTCRTEYFVSNR-TNYISIRKTPE 180

  Fly   232 INSCR-QRYATHSVLQTTP---YTFRDDKTIWPIL-----------------KSQSHCNLTIDNN 275
            :.:|: ...|.|:.....|   ..|...|::  |:                 .|.:|...|...:
  Fly   181 VKTCKPYSEAVHTTRSNVPPNTCEFDHQKSV--IIGNEAIYGMSPHNETGYYLSMAHAKGTTLIH 243

  Fly   276 VYK---EIKCLETHLLVPFSNAS--------SGALTTSTSRLKLDGVE--SYSAGEFLEQNPELV 327
            .::   |.:.:.:.||:.|.|.:        ..::....|.|:|..::  ..:.|...:|...|:
  Fly   244 TFESTGEAQFINSELLLNFLNETPIDNPIDIETSMAAEPSNLELQRLDPNDPTGGRSPQQQETLI 308

  Fly   328 ERRATLVFDHTPAV--------KPSHDEIKAARELLVEMCRVGFPNIQREFIDVFTNFLQTSKSL 384
            .:..||:.....|:        :|....:....:||.||.......:.|| :|:.|::.|     
  Fly   309 AQAGTLLDSLAEALETTEFKFSEPYDSTLSDVIKLLSEMDFDSLTKLYRE-VDIGTSYRQ----- 367

  Fly   385 DYKTLSVLLQRSASTCEQGRNHLLESLPFIGSTASYKVMRDQIINEKLTK-QMAHDWMTALSF-I 447
                            |..||...|.:|.||:.||..:....::| |||| |:|...:..:.| |
  Fly   368 ----------------ETIRNIFHEIIPRIGTKASVFLTHHLVLN-KLTKPQIAVQLLIPMPFHI 415

  Fly   448 TRPDEETLETFHSILEYAKNRLDAEYT--LGATAVVHSFCKHHEACEENLRVQQIINLLE-TEFL 509
            .....|.::.....|....:|.|....  |....::|           |:.|.:.|:..: .|::
  Fly   416 FELSAELVQKCEDFLNIGPDRPDVRQAAILSFATLIH-----------NVYVAKGIDKEKFEEYV 469

  Fly   510 NLY-NLFKGERRTRERMVILLKGLGNIGVVSSAFAEQLQWIIREDEAPVDIRLHG-----ILAFR 568
            ..| |.:..:|...::| :.|:||.|:.:  ...|..|:.|:::.....|::...     .||.|
  Fly   470 QKYFNAYLSDRDFDQKM-LYLQGLNNLQL--GNVANYLEPIVQDPNEHEDLKFQAAWTTLALADR 531

  Fly   569 RVDCARHRSYFLDNYGNYTLNSELRIYSY-LQAMRCPDYISVGVIKSILEHEEINQVGSFVWSHL 632
            |.:  |....:...:.:...:.|||:.:. |..:..|....:..|..|::.|....:.::..:.:
  Fly   532 RAE--RIYEVYWPIFESRNASLELRVAAVTLLLISNPTAARLISIHRIIQSETDPHMINYYRTTV 594

  Fly   633 TNLAKSNSPVRIEAQGLL--LNDELSERFKMDIRKF-SRNYEHSLFFDEYNFGTTTDANVIFGTD 694
            |:::::..|.....:.||  ::..|.:  |.:.|.: :.||.......::..|......::....
  Fly   595 TSISETTYPCYQHLRRLLSYMHRHLPQ--KPESRYWVTGNYIFDYRDSKFGIGAMLQVFLVGDPK 657

  Fly   695 SYLPRIASVNFTADLFGQSVNFFEFTARAEGLEELAANAFGPKG---PLSGQLLRKKLSFLNRWL 756
            |.:|.:|...|..:..|:.........:|.||.:...|....:.   |.:.:.::..|:.|...:
  Fly   658 SDMPVVAFFKFDTEALGKFTGQLALYIKARGLPDTILNKMQSRNGSDPFTFKSIKALLAMLQAPI 722

  Fly   757 GNESAEEDDTLENLLSLDNLRLKRKAQEQARASEEEVDEDYDFEESLEGNKRQKRDVSTTRKQEI 821
            .|   .:|..||.:|.::...:                                           
  Fly   723 IN---SKDLHLEFILQMEGKTV------------------------------------------- 741

  Fly   822 DRNVDSLGYKLKYDYNNPRAQFGLRVFGNDLRYFNV-ESLVEVMALAAKFN------PFQQAKNV 879
                      |.|..|.       |:| ..|.|.|: |.:.:::...:..|      ||..    
  Fly   742 ----------LSYYLNQ-------RMF-RQLTYDNILERMQQIIRTDSHINMQTVRWPFMN---- 784

  Fly   880 LSGKEFTYTKSRVFLDASYTVPLAVGLPLAIHAFGASSIDLRVS------GNLDEM--DPPTDWH 936
                             .||||..:|.        :|.:.|:.:      ||:.|.  .|.|...
  Fly   785 -----------------RYTVPTVLGT--------SSDVLLQTTVLTSLRGNITEQRNSPITKHT 824

  Fly   937 FDVEGQFKPSVSV-----DVITTMQTDMFWEQS---GIKVKSNLYSNSELVAKLKVRGRNLVSFS 993
            .:::.::....||     :....:..::..||.   .|...|.|:.|..        |.....:|
  Fly   825 LEIDARYSSYASVRSRSYNPFLNLDHEINREQGFLIYIPFSSELHLNES--------GSKCRRYS 881

  Fly   994 FDLPRDKNEIFSVRSELLVQKR------------EEQLPQAGIANRSANSTCTWPVLDQAIGLQM 1046
            |..|::.....|.:|..:.:.|            |..:|:   .........::|:.|..:.|.|
  Fly   882 FSRPQNLTSGLSFKSRAVTKTRGLITKTAAAPFEEIMVPE---GRNDVVQLFSYPMTDLGVRLSM 943

  Fly  1047 CSHYSVPDLSNATEI--YPSLLLAGPLNFSLILKKSDLSAKKYVFEYKWDQQEEDNNFSLVFTTP 1109
                    .:|..|:  |..:||           ||:.:               :|.||      
  Fly   944 --------TTNLNELIKYRGMLL-----------KSEFT---------------ENGFS------ 968

  Fly  1110 GSKVPRVLVANVTKVPDAFNASVAFVNGPNRVSAGCSYDGNPDFRRLDIYLDTNGNRSLDLGMEL 1174
            |:.|...|:               ::.|..::|                        |:.||.: 
  Fly   969 GNMVVNALM---------------YIFGFTQLS------------------------SIHLGHD- 993

  Fly  1175 RRHQDFTAWIYNPRMLLAINGVNITGLAGTVKVNEKNGIKQHDVDLSFETKKLQAVIKGNVVQSE 1239
               ::||..:|                      ||||            |:     |:||....:
  Fly   994 ---RNFTMLMY----------------------NEKN------------TR-----IEGNFCAED 1016

  Fly  1240 ITTSTNM-------TIKYRFQANKIEEINFAGKLVNNGDKSKTEYRGNMKLQTSAYPKLNFASES 1297
            :..:::|       |:::....|:    |.|...:         :|.|:.|...|      :::|
  Fly  1017 VLKTSDMKGKQIGLTLEHTDHMNE----NHAADAL---------HRWNITLDVLA------STKS 1062

  Fly  1298 TWLSLQGHTEGMITYNNAPDYVNPNYTSLVRLIFARSHSEDSFLDGTQTRASLELKLPRSKIDYR 1362
            .|..|.|..:     .|:.|                  .||.:...|             |:.|.
  Fly  1063 NWFKLTGQVQ-----RNSKD------------------DEDDWKACT-------------KLTYE 1091

  Fly  1363 ILVKHKE-HIKNGTEHNVIVGL----KYTPEKEITGLFSVHL-PRRNLFAIDAYMNVTVPEFNSC 1421
            .||..|. |..||   :|:.||    ...|||..|..|:... |..:..|......:::.:.:.|
  Fly  1092 PLVFTKRPHTLNG---DVVFGLATEESECPEKGSTVQFAARAGPSEHARAFLRSDKISLTDTDFC 1153

  Fly  1422 TAS-LKVNEKATKDYI---IFINGSWFTGHSVAVK-----------ANYKDR------SSRVQAL 1465
            ... ||.:...|..|.   .|.|.:..|.:.:.:|           :|..|.      :.:|.:|
  Fly  1154 PKEVLKFSPIPTSRYCKRSNFENFTSITQYDMDLKFDNMPAWFELWSNRLDHLVSALSADKVDSL 1218

  Fly  1466 H-----HLKMIVESPSFNI-TSLN-IIYRRKQLLIFYDIQAKYDQDPYGLT----IQYASNAHNR 1519
            |     ::.|......|.: ..:| :.:|..|:..||.:.:|:|.. :.||    ::.:.:..|.
  Fly  1219 HMSQEINISMQTPQDQFRLAVEVNGVKWRFHQIPFFYKLDSKFDAS-HELTFDSGLKRSCSVING 1282

  Fly  1520 NTNAEVRLKVKERDYWINAKLLSEQPKLLQL 1550
            ..|.       ..||.||.:.::.:|..|.|
  Fly  1283 IVNT-------FDDYLINLREIAVRPDCLTL 1306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 137/650 (21%)
DUF1943 665..1012 CDD:286281 58/374 (16%)
DUF1081 1029..1122 CDD:283982 17/95 (18%)
VWD 3741..3908 CDD:295339
C8 3951..4014 CDD:285899
cv-dNP_732076.1 LPD_N 28..589 CDD:214755 137/644 (21%)
DUF1943 632..>813 CDD:286281 41/274 (15%)
VWD 1277..1435 CDD:295339 9/38 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C368185742
eggNOG 1 0.900 E1_KOG4338
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23345
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.