DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and APOB

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:NP_000375.3 Gene:APOB HGNCID:603 Length:4563 Species:Homo sapiens

Alignment Length:4921 Identity:960/4922 (20%)
Similarity:1648/4922 (33%) Gaps:1594/4922 (32%)


  Fly    12 LLLLIAHTQAVRENPLKDPRICGRPQCDSKSAKFNYGEQLYKYQYTVAVRTEFAGSGDNSSDLLL 76
            ||||:|..:| .|..|::..:.    |...:.:|.:..: |.|.|.....:...|:.|:.|...:
Human    18 LLLLLAGARA-EEEMLENVSLV----CPKDATRFKHLRK-YTYNYEAESSSGVPGTADSRSATRI 76

  Fly    77 KSDLEIFFPKPCEGYLRINDAKLYDTLDEL---NDNESDSSEKTKEYDYYDNLANEESESQNYDN 138
            ...:|:..|:.|...|:.:..    ||.|:   |.......:|||                    
Human    77 NCKVELEVPQLCSFILKTSQC----TLKEVYGFNPEGKALLKKTK-------------------- 117

  Fly   139 MHPKSSDFNVDLTKNLLRFAFHDGLISEVCPQEQETPWVLNIKKGILSAFQNTMMRFDVDANTTE 203
               .|.:|...:::..|:.|..:|....:.|::.|..::||||:||:||..       |...|.|
Human   118 ---NSEEFAAAMSRYELKLAIPEGKQVFLYPEKDEPTYILNIKRGIISALL-------VPPETEE 172

  Fly   204 T-------DVSGQCQVQYALEDTDSSYVT-IRKTKDINSCRQRYATHSVLQTTPYTFRDDKTIWP 260
            .       .|.|.|...:.::....:..| |...:|:..|.:.....:.:..........:.:..
Human   173 AKQVLFLDTVYGNCSTHFTVKTRKGNVATEISTERDLGQCDRFKPIRTGISPLALIKGMTRPLST 237

  Fly   261 ILKSQSHCNLTID---NNVYKEIKCLETHLLVPFSNASS-GALTTSTSRLKLDGVESYSAGEFLE 321
            ::.|...|..|:|   .:|.:.| |.|.||.:|||..:. |.:...|..|||:.....::..|.|
Human   238 LISSSQSCQYTLDAKRKHVAEAI-CKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINSRFFGE 301

  Fly   322 QNPELVERRATLVFDHTPAVKP---SHDEIKAARELLVEMCRVGFPNIQREFIDVFTNFLQTSKS 383
            ..     ::..|.|:.|.:..|   :...:|..:||  :...:...||||  .::|...:...:.
Human   302 GT-----KKMGLAFESTKSTSPPKQAEAVLKTLQEL--KKLTISEQNIQR--ANLFNKLVTELRG 357

  Fly   384 LDYK----------------TLSVLLQRSASTCEQGRNHLLESLPFIGSTASYKVMRDQIINEKL 432
            |..:                ||..|:|.....|.   .|:|:.|.        :|..:.::.:.:
Human   358 LSDEAVTSLLPQLIEVSSPITLQALVQCGQPQCS---THILQWLK--------RVHANPLLIDVV 411

  Fly   433 TKQMAHDWMTALSFITRPDEETLETFHSILEYAKNRLDAEYTLGAT--AVVHSFCKHHEACEENL 495
            |      ::.||  |..|..:.|....::....::|        ||  |:.|:...:|:.  ...
Human   412 T------YLVAL--IPEPSAQQLREIFNMARDQRSR--------ATLYALSHAVNNYHKT--NPT 458

  Fly   496 RVQQIINLLETEFLNLYNLFKGERRTRERMVILLKGLGNIGVVSSAFAEQLQ----WIIREDEAP 556
            ..|:::::.......:.:...|:   .:...::|:.:||:|........:|:    ..::..:..
Human   459 GTQELLDIANYLMEQIQDDCTGD---EDYTYLILRVIGNMGQTMEQLTPELKSSILKCVQSTKPS 520

  Fly   557 VDIRLHGILAFRRVDCA-RHRSYFLDNYGNYTLNSELRIYSYLQAMRCPDYISVGVIKSILEHEE 620
            :.|:...|.|.|:::.. :.:...|..:.:.....:.|:.:||..||.|....:..|..||..|:
Human   521 LMIQKAAIQALRKMEPKDKDQEVLLQTFLDDASPGDKRLAAYLMLMRSPSQADINKIVQILPWEQ 585

  Fly   621 INQVGSFVWSHLTNLAKSNSPVRIEAQGL--LLNDELSER---FKMDIRKFSRNYE--HSLFFDE 678
            ..||.:||.||:.|:..|.   .::.|.|  |:.:.|.|.   ..||.|||||||:  .|:....
Human   586 NEQVKNFVASHIANILNSE---ELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPS 647

  Fly   679 YN-FGTTTDANVIFGTDSYLPRIASVNFTADLFG-QSVNFFEFTARAEGLEELAANAFGPKG--P 739
            .: .....:.|:||..::|||:.:.:..|...|| .|.:..|.....:|.|......||.:|  |
Human   648 LDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPTLEALFGKQGFFP 712

  Fly   740 LSGQLLRKKLSFLNRWLGNESAEEDDTLENLLSLDNLRLKRKAQEQARASEEEVDEDYDFEESLE 804
            .|   :.|.|.::|       .:..|.:..:| :|:....:              :|...::.:.
Human   713 DS---VNKALYWVN-------GQVPDGVSKVL-VDHFGYTK--------------DDKHEQDMVN 752

  Fly   805 GNKRQKRDVSTTRKQEIDRNVDSLGYKLKYDYNNPRAQFGLRVFGNDLRY---FNVESLVEVMAL 866
            |               |..:|:.|...|| ....|.|:..||:.|.:|.:   .:::.|.:::.:
Human   753 G---------------IMLSVEKLIKDLK-SKEVPEARAYLRILGEELGFASLHDLQLLGKLLLM 801

  Fly   867 AAKF---NPFQQAKNVLSGKEFTYTKSRVFLDASYTVPLAVGLPLAIHAFGA------SSIDLRV 922
            .|:.   .|....:.:..|.:..:....:|::.::.:|...||.|.|.:.|.      :.:.|.|
Human   802 GARTLQGIPQMIGEVIRKGSKNDFFLHYIFMENAFELPTGAGLQLQISSSGVIAPGAKAGVKLEV 866

  Fly   923 SGNLDEMDPPTDWHFDVEGQFKPSVSVDVITTMQTDM-FWEQSGIKVKSNLYSNSELVAKLKVRG 986
            :            :...|...||||||:.:|.|...: .:.:||:::.:|.:..|.|.|.:.::.
Human   867 A------------NMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQMNTNFFHESGLEAHVALKA 919

  Fly   987 RNLVSFSFDLPRDKNEIFSVRS----ELLVQKREEQLPQAGIANRSANSTCTWPVLDQAI-GLQM 1046
            ..|   .|.:|..|..:..:..    .|:...:.|.:|.. |.||.     :|.|..|.. ||..
Human   920 GKL---KFIIPSPKRPVKLLSGGNTLHLVSTTKTEVIPPL-IENRQ-----SWSVCKQVFPGLNY 975

  Fly  1047 CSH--YSVPDLSNATEIYPSLLLAGPLNFSLILKKSDLSAKKYVFEYKWDQQEEDNNFSLVFTTP 1109
            |:.  ||....:::...||   |.|.....|.|:.:. ..::|.....::.|.||.  :||.|  
Human   976 CTSGAYSNASSTDSASYYP---LTGDTRLELELRPTG-EIEQYSVSATYELQREDR--ALVDT-- 1032

  Fly  1110 GSKVPRVLVANVTKVPDAFNASVAFVNGPNRVSAGCSYDGN-PDFRRLDIYLDTNGNRSLDLGME 1173
                    :..||:...|...........||.|...|.:.. |||             .:|||..
Human  1033 --------LKFVTQAEGAKQTEATMTFKYNRQSMTLSSEVQIPDF-------------DVDLGTI 1076

  Fly  1174 LRRHQDFTAWIYNPRMLLAINGVNITGLAGTVKVNEKNGIKQHDVDLSFETKKLQAVIKGNV--- 1235
            ||.:.:.|....:.|:.|.|....||.:|          :..|   ||.:||: :..|||.:   
Human  1077 LRVNDESTEGKTSYRLTLDIQNKKITEVA----------LMGH---LSCDTKE-ERKIKGVISIP 1127

  Fly  1236 -----VQSEI----------------TTSTNMTIKYRFQANKIEE-INFAGKLVNNGDKSKTEYR 1278
                 .:|||                .|:...|:..|...:..|| |.|......|.|..|  ..
Human  1128 RLQAEARSEILAHWSPAKLLLQMDSSATAYGSTVSKRVAWHYDEEKIEFEWNTGTNVDTKK--MT 1190

  Fly  1279 GNMKLQTSAYPK------------------LNF--------ASESTWL-----------SLQGHT 1306
            .|..:..|.|||                  :.|        .:.|:||           :||.|.
Human  1191 SNFPVDLSDYPKSLHMYANRLLDHRVPQTDMTFRHVGSKLIVAMSSWLQKASGSLPYTQTLQDHL 1255

  Fly  1307 EGMITYN----NAPDYVNPNYTSLVRLIFARSHSEDSFLDGTQTRASLELKLP-----RSKIDYR 1362
            ..:..:|    ..||:..|..      :|.:|   |..:..|..:.||::::|     :|..|.:
Human  1256 NSLKEFNLQNMGLPDFHIPEN------LFLKS---DGRVKYTLNKNSLKIEIPLPFGGKSSRDLK 1311

  Fly  1363 ILVKHKEHIKNGTEHNVIVGLKYTPEKEITGLFSVHLPRRNL----FAIDAYMNVTVPEFNSCTA 1423
            :|    |.::....|...||.              |||.|..    |.|.....:.||       
Human  1312 ML----ETVRTPALHFKSVGF--------------HLPSREFQVPTFTIPKLYQLQVP------- 1351

  Fly  1424 SLKVNEKATKDYIIFINGSWFTGHSVAVKANYKDRSSRVQALHHLK--MIVESPSFNIT-SLNII 1485
            .|.|.:.:|..|....|  |...:|   ..|.......::|.:|:|  .:|:..|:|:. |....
Human  1352 LLGVLDLSTNVYSNLYN--WSASYS---GGNTSTDHFSLRARYHMKADSVVDLLSYNVQGSGETT 1411

  Fly  1486 YRRKQLLI----------FYDIQAKYD------QDPY--GLTIQYASNAHNRNTNAEVRLKVKER 1532
            |..|....          |.|...|:.      .:|.  ||.|..||::.....:|.|.|..|::
Human  1412 YDHKNTFTLSCDGSLRHKFLDSNIKFSHVEKLGNNPVSKGLLIFDASSSWGPQMSASVHLDSKKK 1476

  Fly  1533 DYWINAKLLSEQPKLLQLEIHMDKIRDVHIQVGLLNVDKRKELSLELKWDANRDPSQRLGLL--- 1594
            .:     |..::.|:           |...:|..........||.:      |||:  .|.|   
Human  1477 QH-----LFVKEVKI-----------DGQFRVSSFYAKGTYGLSCQ------RDPN--TGRLNGE 1517

  Fly  1595 --AEYNS---PGT-----KHYDGNLMITYP--------ERTIHFGFNSF-------TGGPKY--- 1631
              ..:||   .||     ::.||.|.:|..        :.|....:.::       |.| ||   
Human  1518 SNLRFNSSYLQGTNQITGRYEDGTLSLTSTSDLQSGIIKNTASLKYENYELTLKSDTNG-KYKNF 1581

  Fly  1632 --FGKVHASWS-INEVIEFEYEA------------GILPGHTL----------------HNWVKA 1665
              ..|:..::| .|.::..||:|            |.|..|.|                |   ||
Human  1582 ATSNKMDMTFSKQNALLRSEYQADYESLRFFSLLSGSLNSHGLELNADILGTDKINSGAH---KA 1643

  Fly  1666 ELRTPFDGWRVNSLDAGIYSLKNLILVNSTLFWADDQKLQVGYKSDYDVNDQLMSFDVRFGINST 1730
            .||...||...::..    :||..:||               .:::.:....|....::...|..
Human  1644 TLRIGQDGISTSATT----NLKCSLLV---------------LENELNAELGLSGASMKLTTNGR 1689

  Fly  1731 IRDIPTINVKVKHWMDVKKVDTELYLGYSGQN-----DTFNTYSMDSSWEIEK--NQRYNNYSGL 1788
            .|:     ...|..:|.|...|||.||.:.|.     |:.|.::...|.|..|  |....:|:.:
Human  1690 FRE-----HNAKFSLDGKAALTELSLGSAYQAMILGVDSKNIFNFKVSQEGLKLSNDMMGSYAEM 1749

  Fly  1789 V--HLVSPFKGYEKGGLVAHFSLSDQRVVSG----AASLNFDLREFTL--TMNGYVKKFTDNMLT 1845
            .  |..|    ....||...||.....:.|.    ..::|..|:.::|  |:|..: |:....||
Human  1750 KFDHTNS----LNIAGLSLDFSSKLDNIYSSDKFYKQTVNLQLQPYSLVTTLNSDL-KYNALDLT 1809

  Fly  1846 VNITTPLEKF-----GTINARFGLNEKKRHAVAEVRAPTAALGVEVLADIKNLLNFDVKLSVATP 1905
            .|....||..     |.:...:..||.|........|.:|:...:.:|.::. :.|..:|:  |.
Human  1810 NNGKLRLEPLKLHVAGNLKGAYQNNEIKHIYAISSAALSASYKADTVAKVQG-VEFSHRLN--TD 1871

  Fly  1906 IESFQQAAIFALFNPERVDMRGLWNNVTLGFTGVWHMQNITDFEYSYHVFTPLAGFEENG----- 1965
            |.....|          :||...:|:.:|.|:.|        |......||.......||     
Human  1872 IAGLASA----------IDMSTNYNSDSLHFSNV--------FRSVMAPFTMTIDAHTNGNGKLA 1918

  Fly  1966 ------------FIVQ-------------------LLKRKEFVFQLHGKMS-------------- 1985
                        |:::                   |:.||.....|..|:|              
Human  1919 LWGEHTGQLYSKFLLKAEPLAFTFSHDYKGSTSHHLVSRKSISAALEHKVSALLTPAEQTGTWKL 1983

  Fly  1986 -------NY-----------KLGVKINGEPKSDL----------------VNQLGSNKMELEMLY 2016
                   .|           |:||::.|...:||                :|.:.:.:|.     
Human  1984 KTQFNNNEYSQDLDAYNTKDKIGVELTGRTLADLTLLDSPIKVPLLLSEPINIIDALEMR----- 2043

  Fly  2017 DADFKP----LNAETDYKPDAD------------EEYFSYFTNFQVDTLVWPTIVGN---VDIQE 2062
            ||..||    :.|...|..:.|            :|||.  .|.|...:|...:..|   ::|.:
Human  2044 DAVEKPQEFTIVAFVKYDKNQDVHSINLPFFETLQEYFE--RNRQTIIVVLENVQRNLKHINIDQ 2106

  Fly  2063 IIDFY-LVVGHVELPQGKVEFKDRLHYPDYINVHN-----------LLTVTTPFAVAKNIKSIVE 2115
            .:..| ..:|  :|||         ...||:|..|           |..:|..:.:.:|...|..
Human  2107 FVRKYRAALG--KLPQ---------QANDYLNSFNWERQVSHAKEKLTALTKKYRITENDIQIAL 2160

  Fly  2116 YHVDLNFNAFYERVK-FIVNDDKDNTQELGFVFNYTALQDNVKPKAHDVQVTLLT----PYEMLH 2175
            ....:|||....::: :::..|:             .::|:.  ..||:::.:..    ..|.|.
Human  2161 DDAKINFNEKLSQLQTYMIQFDQ-------------YIKDSY--DLHDLKIAIANIIDEIIEKLK 2210

  Fly  2176 EIYVHGHIELDDNAYKGNISAVTAHTHLSMAASIENEDNFLETSVGIQLETDAIPHYGCQVYFKK 2240
            .:..|.||.:       |:.......||    .|||.|                        |.|
Human  2211 SLDEHYHIRV-------NLVKTIHDLHL----FIENID------------------------FNK 2240

  Fly  2241 DFSA-------VDKAIDIRFEVTDNGTLNQL--HISTDWHTDPSYIVNANGRIKTTMLPLQMAST 2296
            ..|:       ||....||.::.:.  |.||  ||.   :.|..::.   |::|.     .:.:.
Human  2241 SGSSTASWIQNVDTKYQIRIQIQEK--LQQLKRHIQ---NIDIQHLA---GKLKQ-----HIEAI 2292

  Fly  2297 SVLVIQGQNPHLNFDLNLLSQNGQSIAYGARANK-----KKDVFNI----EVWTPMKNFRNISMH 2352
            .|.|             ||.|.|.:|:: .|.|.     |..|.|:    ||...:..|| ..:|
Human  2293 DVRV-------------LLDQLGTTISF-ERINDILEHVKHFVINLIGDFEVAEKINAFR-AKVH 2342

  Fly  2353 GTAIRSPRDPGRYDVSGFLYRNMATYEVTGAVRMTNSLPIDVVLRVQPKAGGRDGVIELN----- 2412
            ....|                    |||...:::.    :|.::.:..:...::.:.:|:     
Human  2343 ELIER--------------------YEVDQQIQVL----MDKLVELAHQYKLKETIQKLSNVLQQ 2383

  Fly  2413 -------------IHEAGPKKIRFSFSA-IED-GKMCQMSGGYSVSKTNGAMDFSVLVESTEPEI 2462
                         |.:|..|....||.. ||| .|...|     :.|...:.|:...|:.|..:|
Human  2384 VKIKDYFEKLVGFIDDAVKKLNELSFKTFIEDVNKFLDM-----LIKKLKSFDYHQFVDETNDKI 2443

  Fly  2463 ARINFYGNLSPNSEGSLVGDL-SLETPWKALGIDTVHLHSDVGFLNKGGHIVGEYKIGQYIGRGS 2526
            ..:.          ..|.|:: :||.|.||..:..        ||.:....|..|          
Human  2444 REVT----------QRLNGEIQALELPQKAEALKL--------FLEETKATVAVY---------- 2480

  Fly  2527 CLWSWILAEDMQ----LVLENYLERPNAKPRIVHASAKYQNP----------------------- 2564
                   .|.:|    .::.|:|:...:...:.|..||::..                       
Human  2481 -------LESLQDTKITLIINWLQEALSSASLAHMKAKFRETLEDTRDRMYQMDIQQELQRYLSL 2538

  Fly  2565 -GQTFTQLQAGGRLSVDSKWNL---DVNGSAEYKSVDDFKFRV---------ITALPLPVGDRHQ 2616
             ||.::.|..    .:...|.|   ::...||..|:.|:..|:         :..:...:|....
Human  2539 VGQVYSTLVT----YISDWWTLAAKNLTDFAEQYSIQDWAKRMKALVEQGFTVPEIKTILGTMPA 2599

  Fly  2617 LSASYQGNVISQQFNNPDFVLEASYESFEAQNKLLSRISYKNATNNLKGLGHVEWGKIQNLSVVE 2681
            ...|.|. :....|..|||::.            |:.:...:...|.|.|.::            
Human  2600 FEVSLQA-LQKATFQTPDFIVP------------LTDLRIPSVQINFKDLKNI------------ 2639

  Fly  2682 GDFELLHKQGAQREFSAKIITPKFKNEHTFALTGSYDLE---------KSGHHNVVGSLDYPA-S 2736
                         :..::..||:|...:||.:. |:.::         ::....:...|.:|. .
Human  2640 -------------KIPSRFSTPEFTILNTFHIP-SFTIDFVEMKVKIIRTIDQMLNSELQWPVPD 2690

  Fly  2737 RRITDLDVSVSSLSNMHGIFNSTLPTFLNVSWLKTDFNFTTNNGKSYRYCRCFWPQDTAYFKLNS 2801
            ..:.||.|....|:.:      |||.|........:|...|.|...::......|:    |:|  
Human  2691 IYLRDLKVEDIPLARI------TLPDFRLPEIAIPEFIIPTLNLNDFQVPDLHIPE----FQL-- 2743

  Fly  2802 NYDSDSSNFNHNLNGNVEIEVPLATRHRADIVYGLQKRR--------NQDAGNVKVVYNEKQVLD 2858
                  .:.:|.      ||||...:     :|.:.|.:        |.|.||.....||     
Human  2744 ------PHISHT------IEVPTFGK-----LYSILKIQSPLFTLDANADIGNGTTSANE----- 2786

  Fly  2859 GKYKRLEQAKAPIYKETTDISLENEVKPLGIHFVSTRDASDP-----AGSQDVKHIEIYELRNTQ 2918
                      |.|....| ...|::::.|...|.:....|:|     |..:.||....| ||...
Human  2787 ----------AGIAASIT-AKGESKLEVLNFDFQANAQLSNPKINPLALKESVKFSSKY-LRTEH 2839

  Fly  2919 -------------NFNLTGELHS-RATLKAQDFKVVAIHPNRAVVLSTKYEDVSPEVVRHHS--- 2966
                         ..|....||: :.||:..:..:|.|:....:..:|||         .|.   
Human  2840 GSEMLFFGNAIEGKSNTVASLHTEKNTLELSNGVIVKINNQLTLDSNTKY---------FHKLNI 2895

  Fly  2967 -KLELSETAWIGYNLELGNFSKVGNESQSFALEIFYPKRNLSSSGQYYMTDTNFNSDLSFQWLGG 3030
             ||:.|..|      :|.|             ||    :.|..:|....|.:...|         
Human  2896 PKLDFSSQA------DLRN-------------EI----KTLLKAGHIAWTSSGKGS--------- 2928

  Fly  3031 NYDQQPKIIHSNLQWK-AEPLHRGDREHRT-IALTVAHPL----LEKDINCKATYYRGLRDLLRT 3089
                          || |.|....:..|.: |:.|:..||    |...||.|  :.|..::|:..
Human  2929 --------------WKWACPRFSDEGTHESQISFTIEGPLTSFGLSNKINSK--HLRVNQNLVYE 2977

  Fly  3090 HLTIDYSEYPDQLIELGAQLTDRYSELGHTNYT---FHVYGK---HIASELDVQLNGTL--AAMN 3146
            ..::::|:     :|:.:|:..::  :||:..|   ..::|:   ......|..|||.:  ...|
Human  2978 SGSLNFSK-----LEIQSQVDSQH--VGHSVLTAKGMALFGEGKAEFTGRHDAHLNGKVIGTLKN 3035

  Fly  3147 SYYKT----ESTAHYKRD-----IFPAR----------YGKFL------ALLDVNKRELEYERQS 3186
            |.:.:    |.||....:     .||.|          |..||      |...|:.|..:|:...
Human  3036 SLFFSAQPFEITASTNNEGNLKVRFPLRLTGKIDFLNNYALFLSPSAQQASWQVSARFNQYKYNQ 3100

  Fly  3187 PFHA------VRLHL----------------LPTIRYPIYGLNATIWDTPDTNHSGYIYMDILER 3229
            .|.|      :..|:                :|.:|.|.     ||..||...            
Human  3101 NFSAGNNENIMEAHVGINGEANLDFLNIPLTIPEMRLPY-----TIITTPPLK------------ 3148

  Fly  3230 YARMDFNLTEDASQNLQMVGYIPDTRSAFLDIWRNYEEIRVIDVS---SYLKMNHSRLITGRFHW 3291
                ||:|.|...    :..::..|:.:|             |:|   .|.|..|...||...  
Human  3149 ----DFSLWEKTG----LKEFLKTTKQSF-------------DLSVKAQYKKNKHRHSITNPL-- 3190

  Fly  3292 RPSIRQEVREKIQAVGKSVYSSFSEGIDFWIKSIYTETTESMGVVWNTAK-EYNRDFIDDIGQLS 3355
             ..:.:.:.:.|::..:....:.:..:||..|| |.||.    :.::..| |.:.|.:....|:.
Human  3191 -AVLCEFISQSIKSFDRHFEKNRNNALDFVTKS-YNETK----IKFDKYKAEKSHDELPRTFQIP 3249

  Fly  3356 VLEEDLADLRLFVNQSYEANDFYIK------------------------NVVNFTLTILDELAI- 3395
            .....:.::        |.:.|.|:                        .|.::|| ||..|.: 
Human  3250 GYTVPVVNV--------EVSPFTIEMSAFGYVFPKAVSMPSFSILGSDVRVPSYTL-ILPSLELP 3305

  Fly  3396 -----RDHIESLPKIFSELW-------QAMGD--SGKALRNSIVWL------------IETIKTT 3434
                 |:...|||. |.||.       .|||:  ...:.::|::.|            :..:.::
Human  3306 VLHVPRNLKLSLPD-FKELCTISHIFIPAMGNITYDFSFKSSVITLNTNAELFNQSDIVAHLLSS 3369

  Fly  3435 YNNLLDAVARFFHGES-LVYISGL-LEKGIAKYDSFIKDLHIKFIKY-IENLWHKTWTLAENHWK 3496
            .::::||:.....|.: |....|| |...::..:.|::..|...:.. .:|:.....|..:....
Human  3370 SSSVIDALQYKLEGTTRLTRKRGLKLATALSLSNKFVEGSHNSTVSLTTKNMEVSVATTTKAQIP 3434

  Fly  3497 AVLKRFEPHL---------------FKMISFIETTAWNLSKEVFDFIYKRTNELAESPYFNKVSS 3546
            .:...|:..|               || ..|..:..::.:|...|  :|.:.|...| ||:..||
Human  3435 ILRMNFKQELNGNTKSKPTVSSSMEFK-YDFNSSMLYSTAKGAVD--HKLSLESLTS-YFSIESS 3495

  Fly  3547 FTADAE-----RLYRDFKANDAITNIKKYSTIAWNFVKEKYFKLVPFGAELNEVLTEIWQ-EIKE 3605
            ...|.:     |.|....|::|.|.:...||       ....||     :....:.:||. |:||
Human  3496 TKGDVKGSVLSREYSGTIASEANTYLNSKST-------RSSVKL-----QGTSKIDDIWNLEVKE 3548

  Fly  3606 LEKIDQVQIMVQKYYEVMAKVDW---VADELQLEHRLHQVYGLVRNKFRNYAMNALETADMYREA 3667
               ....:..:|:.|.:     |   ..:.||||       ||......:.:...||.:.....|
Human  3549 ---NFAGEATLQRIYSL-----WEHSTKNHLQLE-------GLFFTNGEHTSKATLELSPWQMSA 3598

  Fly  3668 KTKFVFDPEVGIIDLEQKLPMSWH---------AFNETPRFEEIP-EYQVLAKAQSFFSETNSSI 3722
                       ::.:....|.|:|         |.|...:.::|. :.:|...:.||.|:...|.
Human  3599 -----------LVQVHASQPSSFHDFPDLGQEVALNANTKNQKIRWKNEVRIHSGSFQSQVELSN 3652

  Fly  3723 VMKLYNMRTHLD-----------PKTWLPPYYSRAL----------LIDSRHYMTFDQRYVGLNL 3766
            ..:    :.|||           .|..:.|.|.::|          .|..|.::.....:|    
Human  3653 DQE----KAHLDIAGSLEGHLRFLKNIILPVYDKSLWDFLKLDVTTSIGRRQHLRVSTAFV---- 3709

  Fly  3767 NFDELGNGRSTSQCSYLLAHDF------------------FKRNFTLLLEPASKSLAGQGLTRKL 3813
             :.:..||.|.|....:||..|                  |...||.|..|:.          ||
Human  3710 -YTKNPNGYSFSIPVKVLADKFIIPGLKLNDLNSVLVMPTFHVPFTDLQVPSC----------KL 3763

  Fly  3814 SFIANGQLIEI--DLETDHISINGNPQPILP-LKLGDVNIHRDLDVLSITSDTEFSLHCNVQFDL 3875
            .|    :.|:|  .|.|...::|   .|.|| :|..:|      |||:..|..|.||        
Human  3764 DF----REIQIYKKLRTSSFALN---LPTLPEVKFPEV------DVLTKYSQPEDSL-------- 3807

  Fly  3876 CWFEVSGWYFGRTAGLLGTLNNEPYDEYTMSSGVISNETQLFTDSWSLKQCRQNKLAQTQEVSQE 3940
                                  .|:.|.|:.      |:||....::|              .:.
Human  3808 ----------------------IPFFEITVP------ESQLTVSQFTL--------------PKS 3830

  Fly  3941 VSDACTSFFRTGILATCSAVLDPTPFYEMCMDLGMKSPPIRKGHPAVKGACAAALAYIEACTALK 4005
            |||        ||.|               :||               .|.|..:|..|..|.: 
Human  3831 VSD--------GIAA---------------LDL---------------NAVANKIADFELPTII- 3856

  Fly  4006 VPMRVPSQCVFCQLSNGSYVPEGTFMELSGPEIPKSSDVV--FIVEAKECNANLKTS-KNIMTVV 4067
                ||.|.:        .:|...|...:|..||....:.  |.|::...||....| ||....|
Human  3857 ----VPEQTI--------EIPSIKFSVPAGIVIPSFQALTARFEVDSPVYNATWSASLKNKADYV 3909

  Fly  4068 SSIEEQLQAAKITNNRYAVVAFGGVSPYD-----KARSVIYEHNEFTSKPEQLADYFG------- 4120
            .::.:...::.:....|.:...|.....|     |.:.. :.|.:|:::.|:...|.|       
Human  3910 ETVLDSTCSSTVQFLEYELNVLGTHKIEDGTLASKTKGT-FAHRDFSAEYEEDGKYEGLQEWEGK 3973

  Fly  4121 -HINTGNGSSNDILMAISAAAKLNFRPGVSKTFILLSCSKCAARDMRFDYTSILQYLLEEGVNLH 4184
             |:|..:.:..|          |:.|....|..|..|.:..|...:..|                
Human  3974 AHLNIKSPAFTD----------LHLRYQKDKKGISTSAASPAVGTVGMD---------------- 4012

  Fly  4185 ILADTEFDFERNKKLRHFF----GLDSKLVYSK---RFPEGDAETR 4223
              .|.:.||   .|...::    ..|.||...|   |..|.|.||:
Human  4013 --MDEDDDF---SKWNFYYSPQSSPDKKLTIFKTELRVRESDEETQ 4053

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 124/625 (20%)
DUF1943 665..1012 CDD:286281 77/370 (21%)
DUF1081 1029..1122 CDD:283982 22/96 (23%)
VWD 3741..3908 CDD:295339 41/198 (21%)
C8 3951..4014 CDD:285899 13/63 (21%)
APOBNP_000375.3 Heparin-binding 32..126 22/126 (17%)
Heparin-binding 232..306 20/80 (25%)
Heparin-binding 902..959 12/61 (20%)
Heparin-binding 2043..2178 31/153 (20%)
Heparin-binding 3161..3236 18/96 (19%)
Basic (possible receptor binding region) 3174..3184 3/10 (30%)
LDL receptor binding 3373..3393 5/20 (25%)
Heparin-binding 3383..3516 27/137 (20%)
Basic (possible receptor binding region) 3386..3394 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 1 Normalized mean entropy S10273
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7740
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.