DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and apobb.1

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:XP_005160686.1 Gene:apobb.1 ZFINID:ZDB-GENE-030131-9732 Length:3739 Species:Danio rerio

Alignment Length:4500 Identity:842/4500 (19%)
Similarity:1465/4500 (33%) Gaps:1555/4500 (35%)


  Fly     1 MGGLKPQAAIWLLLL---IAHTQAVRENPLKDPRICGRPQCDSKSAKFNYGEQLYKYQYTVAVRT 62
            |||.|    :.||||   ||.:.|..|.|           | ..:.:|   :...||:||....:
Zfish     1 MGGTK----LCLLLLLCAIALSYAQEEEP-----------C-LLAKRF---KSFQKYEYTYETES 46

  Fly    63 EFAGSGD-NSSDLLLKSDLEIFFPKPCEGYLRINDAKLYDTLDELNDNESDSSEKTKEYDYYDNL 126
            ..|.:|. |......|.::|:  |:.|...:...:.:|.|.:|      .|:..|    ..:.:.
Zfish    47 LNALNGAINGPKARCKVEIEV--PRICSYIVHTTECELSDVID------VDAEGK----PIFMSS 99

  Fly   127 ANEESESQNYDNMHPKSSDFNVDLTKNLLRFAFHDGLISEVCPQEQETPWVLNIKKGILSAFQNT 191
            |..|:              |...:.||.|:|........::.|:..|...:||.|:|::||....
Zfish   100 AGAEA--------------FKAAMAKNPLKFTVEGDNDIKLFPENDEPANILNFKRGLISALAAP 150

  Fly   192 MMRFDVDANTTETDVSGQCQVQYALEDTDSSYVTIRKTKDINSC------RQRYATHSVLQTTPY 250
            ::  :.|.|.....|.|.|:..|::.........:...:|:::|      :...:..:::....|
Zfish   151 VL--EEDRNRRMPTVYGMCRTDYSVNARQDIATDVVLNRDLSNCDKFSPVKDHTSPLALITGMQY 213

  Fly   251 TFRDDKTIWPILKSQSHCNLTIDNNV--YKEIKCLETHLLVPFS-NASSGALTTSTSRLKLDGVE 312
            ....      :::|...||...||:.  .....|.|.|:|:||| ....|........|.|.||.
Zfish   214 PLAQ------LIRSSQTCNYKFDNDQKHMTSASCSEKHMLLPFSYKGEHGVSNVGKQALTLVGVS 272

  Fly   313 SYSAGEFLEQNPELVERRATLVFDHTPA-VKPSH--DEIKAARELLVEMCRVGFPNIQREFIDVF 374
            .|:.                .:|||..| :|..|  |.|.:...:   ..:....:|.|:..|:.
Zfish   273 VYNG----------------RIFDHNEANMKTLHLDDSIDSVHPI---QDKDAILSILRDLNDLS 318

  Fly   375 -TNFLQTSKSLDYKTLSVLLQRSASTCEQGRNHLLE-SLPFI-----------GSTASYKVMR-- 424
             |...:....|.:|.:|.:.:.||.:........|| |.|.:           .::|..:|:|  
Zfish   319 ETTNGENRAHLAHKLISTIRKMSAESLSAALPEALEISRPLVYQALFQCGTPECTSAILRVLRTF 383

  Fly   425 -------DQIINEKLTKQMAHDWMTALSFITRPDEETLETFHSILEYAKNRLDAEYTLGATAVVH 482
                   |..:             .|:..:..|..:.:|   .:||.||.:.........:..|.
Zfish   384 DRSSVEIDAAV-------------YAMGMVPNPSRDLVE---EMLEMAKFKSSKPIYYALSNAVK 432

  Fly   483 SFCKHHEACEENLR------VQQIINLLETEFLNLYNLFKGE-RRTRERMVILLKGLGN----IG 536
            ...:..::....::      ::||                |: ...:|.:.:.|:.:||    :|
Zfish   433 RLYEVEKSVTPEIKAVADYTLEQI----------------GDCTGNQEHVYLSLRVIGNMAAAVG 481

  Fly   537 VVSSAFAEQLQWIIREDEAPVDIRLHGILAFRRVDCA-RHRSYFLDNYGNYTLNSELRIYSYLQA 600
            ..|.|....:...|.:..|..:::...|..||..... ..|...:....:.....:.|:.:||..
Zfish   482 AASPALKSAVIQCINQPAASPEVQQAAIQVFRLTSVPDEGREVLMKVIFDKAAPIQKRVAAYLIV 546

  Fly   601 MRCPDYISVGVIKSILEHEEINQVGSFVWSHLTNLAKSNS----PVRIEAQGLLLNDELSERFKM 661
            |:.|....:..:.:.|.:.:..|..|||.|||.|:..|.:    .:|::....|..:|:|.  ..
Zfish   547 MKDPQPTELAQLVAALPNNKNCQAMSFVNSHLRNILSSTTSETGELRVKILNALQGNEIST--ST 609

  Fly   662 DIRKFSRNYEHSLFFDEYNFGTTTDANVIFGTDSYLPRIASVNFTADLFGQSVNFFEFTARAEGL 726
            |..||||||:..          :.:.||||.::..||....:..|.:.||..|:.||.....:||
Zfish   610 DPTKFSRNYKIG----------SLEGNVIFESEELLPNEVILEMTLNAFGYDVDMFEIGLNGKGL 664

  Fly   727 EELAANAFGPKGPLSGQLLRKKLSFLNRWLGNESAEEDDTLENLLSLDNLRLKRKAQEQARASEE 791
            |                                     .|::.|:.:|.. .:...|:....:.:
Zfish   665 E-------------------------------------PTVDALIGIDGF-FRDTMQKTINYAAD 691

  Fly   792 EVDEDYDFEESL-----EGNKRQKRDVSTTRKQEIDRNVDSLGYKLKYDYNNPRAQFGLRVFGND 851
            :|....|..:|:     ...|.||...|..:  ||..||:.|..|||.. :||.|...||:.|.:
Zfish   692 KVPRGNDIMQSMFPTLWNNIKMQKAPQSIVK--EITNNVNKLIQKLKVQ-DNPEAMIYLRLLGAE 753

  Fly   852 LRYF---NVESLVEVMALAAK----FNPFQQAKNVLSGKEFTYTKSRVFLDASYTVPLAVGLPLA 909
            :.|.   :||.:....||..|    ..|....:|:.|..........||:|..:.:|...|:||.
Zfish   754 MGYLKTNDVEDMAYSAALLTKSLLNMFPTDFLRNLYSSVNNNLFLHYVFMDNEFYLPTGTGIPLR 818

  Fly   910 IHAFG--ASSI--DLRVSGNLDEMDPPTDWHFDVEGQFKPSVSVDVITTMQTDM-FWEQSGIKVK 969
            :...|  |..:  .|:::.::.|:            .|.||..|:.:|.:...: .:.:||:::.
Zfish   819 VALSGTFAPGVKGGLKLARDMSEV------------AFMPSAGVEFVTEVGALLPEYVESGLEMH 871

  Fly   970 SNLYSNSELVAKLKVRGRNLVSFSFDLPRDKNEIFSVRSEL--LVQKREEQLPQAGIANRSANST 1032
            :|:|..|.|..|:.|..:.. ..:...|:...::.||.:.|  :.....:::|.  :|.......
Zfish   872 TNIYHESGLKVKVAVTNKQF-KLTIPTPKTSTKLISVSNSLYSVTGTEIKRIPP--LAEHVKARK 933

  Fly  1033 CTWPVLDQAIGLQMCSHYSVPDLSNA--TEIYPSLLLAGPLNFSL-ILKKSDLSAKKYVFEYKWD 1094
            || |.:.   |.|.|   .|...|||  .:..|...|.|...|:: |....::|:.....:|.:|
Zfish   934 CT-PFIP---GFQYC---GVMQYSNAFSNDAAPYFPLTGDSKFAIEIHPTGEVSSYTATADYAYD 991

  Fly  1095 QQEEDNNFSLVFTTPGSKVPRVLVANVTKVPDAFNASVAFVNGPNRVSAGCSYDGNPDFRRLDIY 1159
            .:::...|       |.|...:...::.|        :.|......|||....   ||:      
Zfish   992 GKDDTVTF-------GLKAEGITFESIVK--------LTFDRQNYEVSADVQI---PDY------ 1032

  Fly  1160 LDTNGNRSLDLGMELRRH-------QDFTAWIYNPRMLLAINGVNITGLA--------------- 1202
                     ||...:|.|       .|.|..|....|...:...::.|||               
Zfish  1033 ---------DLEAGIRVHAVDRKAQSDATHSIQIDLMKKNVPEASLIGLAKIGSMKDAMLQVQLL 1088

  Fly  1203 -----------------GTVKVNEKNGIKQHDVD-------LSFETKKLQAVIKGNV---VQSEI 1240
                             ..:||..::.||..::.       |.::.::::|.:..:|   :.:.|
Zfish  1089 IPNFETDAKVTATLKNTDELKVELESDIKLPEMTSSIQKMILKYDAEEIEAEVSSDVTTEIHNII 1153

  Fly  1241 TT----------------------------------------STNMTIKYRFQANKIEEINFAGK 1265
            ||                                        |.|:......:...:.|..|..|
Zfish  1154 TTDAIKATFNDILDQEIGTSDKKIRDVLTQFVEASNAYLEQFSPNIPYVQELRIPALPEFTFPKK 1218

  Fly  1266 LVNN----------------------GDKSKTEYRGNMKLQTSAYPKLN---------------- 1292
            |..|                      |.|:..::.....|:|   |.||                
Zfish  1219 LFLNAEGAAKYKFGQNYYTITIPVPLGGKTSRDFNLPAALET---PVLNVPQLDLQVKSINIPLP 1280

  Fly  1293 --FASESTWLSLQGHTEGMITYNNAPDYVN--------------PNYTSLVRL-------IFARS 1334
              |..||..|||....:..::...:.::.:              |.|::::.:       :.:..
Zfish  1281 VFFIPESLSLSLPLVAKAEVSSKLSSNFYDMEAKASAGSELVDKPTYSAMIEVTGTSPVDLLSFK 1345

  Fly  1335 HSEDSFLDG-------TQTRASLELKLPRSKIDY--------RILVKHKEH--------IKNGTE 1376
            ....:||.|       |:.::||..||..:.::|        :|.:|....        :|...|
Zfish  1346 IEGSTFLVGRLGESLKTEMKSSLNHKLLEASVNYFEEITTGEKITMKSSSKMEAKSPFGLKISLE 1410

  Fly  1377 HNVIVGLKYTPEKEITG----LFSVH----------------LPRRNLFAIDAYMNVTVPEFNSC 1421
            |...|||   .|.||:|    |.|:.                ||.:....||             
Zfish  1411 HTGQVGL---DEDEISGDGNLLGSIKAGPLNGEVALRQSLILLPFKPELKID------------- 1459

  Fly  1422 TASLKVN-EKATKDYII---FINGSW-FTGHSVAVKANYKDRSSRVQALHHLKMIVESPSFNITS 1481
             :||||: |:...:.||   |.||.. ||..|.|.:.|          |.|:             
Zfish  1460 -SSLKVDLEQIQAENIIEAAFANGELSFTSKSTAFQDN----------LIHV------------- 1500

  Fly  1482 LNIIYRRKQLLIFYDIQAKYDQDPYGLTIQYASNAHNRNTNAEVRLKVKERDYWINAKLLSEQPK 1546
            ..:.|:..||.:..|.:||    .:||.||..:.|     :|...|        :|.|:.:....
Zfish  1501 AELAYKESQLALKSDARAK----AFGLNIQNVAEA-----SASFNL--------VNVKIDTNVDT 1548

  Fly  1547 LLQLEIHMDKIRDVHIQVGLLNVDKRKELSLELKWDANRDPSQ------------RLGLLAEYNS 1599
            |..     :::|...|.....|       .|::|.||:.:..:            |.||:.    
Zfish  1549 LFG-----NRVRSQFIAALDAN-------GLDVKSDASANLDEHTASHMCSLSLTRNGLVT---- 1597

  Fly  1600 PGTKHYDGNLMITYPERTIHFGFNSFTGGPKYFG---KVHASWSINEVIEFEYEAGILPGHTLHN 1661
                  .|:.::..|:..:... |.|.|.....|   .|.......||             |:.|
Zfish  1598 ------IGSTLLECPDMPLTLQ-NKFNGALDTSGLSLSVETKGKFVEV-------------TIEN 1642

  Fly  1662 WVKAELRTPFDGWRVNSLDAGIYSLKNLILVNSTLFWADDQKLQVGYKSDYDVNDQLMSFDVRFG 1726
                          .|||.|.:.|:..:...||     ||..    |..|:.:  ||..:.....
Zfish  1643 --------------TNSLSASLSSVDFISKANS-----DDGT----YVHDFSL--QLQPYSTSLK 1682

  Fly  1727 INSTIRDIPTINVKVKHWMDVKKVDTELYLGYSGQNDTFNTYSMDSSWEIEKNQRYNNYSGLVHL 1791
            |::.:.   .:|:|:.:....|.      |.|:.  |...::.:.|..:..||.....|..||  
Zfish  1683 ISNNLN---ALNIKLINEAQFKA------LPYAA--DLTGSWKLSSGTDELKNTYEIKYEDLV-- 1734

  Fly  1792 VSPFKGYEKGGLV-----AHFSLSDQRVVSG-------AASLNFDLREFTLTMNGYVKKFTDNM- 1843
                 ...|.||.     :|.|.:.:..|:|       .::.|.....|...::.....|..|: 
Zfish  1735 -----ATAKCGLTGKLMGSHMSQNTEIEVAGLSVTYGSESNFNSQYLRFNSDLHAAAVPFRFNVD 1794

  Fly  1844 LTVNITTPLEKFGTINAR-FGLNEKKRHAVA-----EVRAPTAALGVEVLADIKNLLNFDVKL-S 1901
            ..||....|..:|..:|: :.....|...:|     |.|..|.   ..:..|:....|.|.|: :
Zfish  1795 AMVNADGDLYLYGKQSAQVYSKFLMKAEPLAFAHSHECRVSTT---YNLYDDLVFETNLDNKIDT 1856

  Fly  1902 VATPIESFQQAAIFALFN-------------PER--VDMRGLWNNVTLGFTGVWHMQNITDFEYS 1951
            |.||.|......:.:.||             |||  |:|.|         :.:.::.|..|.:..
Zfish  1857 VLTPSEQKATVRVKSKFNNHEFNKDLSAYNTPERLGVEMSG---------SIITNIFNTVDSDNQ 1912

  Fly  1952 YHVFTPLAGFEENG--------------FIVQLLK---------------RKEFVFQLHGKMSNY 1987
            .|.|:....:::|.              |.:|.:|               |:|.:.::. |::.|
Zfish  1913 DHFFSAFLKYDKNSNSRALSLPFIDEFPFDLQHMKLAVLRIVEAMQSYINREEIIVEIQ-KLATY 1976

  Fly  1988 KLGVKINGEPKSDLVNQLGSNK------MELEMLYD-------------ADFKP----LNAETD- 2028
                      .||.||:|...:      .:|..||:             .:.||    |..|.| 
Zfish  1977 ----------VSDFVNELNLEEKIIKFSKDLTALYEDYGITLDDLEASLMNLKPVLLKLVTELDT 2031

  Fly  2029 ----------------YKPDADEEYF-----SYFTNFQVDTLVWPTI------VGNVDIQEI--- 2063
                            ...||..:.|     |:...:.|..:|...|      :..:|:..|   
Zfish  2032 YVVEIEKIVREIITSGTPSDAAIQRFTDILNSFNEKYDVKAIVLTVIEAIEKFLREIDVMSIKGS 2096

  Fly  2064 -------IDFYLVVGHVELPQGKVE------------------------FKDRLHYPDYINVHNL 2097
                   :|.|..:      :.|||                        |.....:.||.:  ||
Zfish  2097 REVFKQYVDEYFAI------KSKVEEILSELKQFVANFDQEKFTEDVKNFVTSARFRDYAD--NL 2153

  Fly  2098 LTVTTPFAVAK----NIKSIVEYHVDL------NFNAFYERVKFIV----NDDKDNT-----QEL 2143
                    |||    .|..|:|....|      ..||.|..|:.|:    .|.|..|     .||
Zfish  2154 --------VAKIPTEQISKILEKAKQLLNLLGNRMNAIYTNVREILVKSGVDKKIETLLKKVVEL 2210

  Fly  2144 GFVFNYTALQDNVKPKAHDVQVTLLTPY-----------------EMLHEI---------YVHGH 2182
            ...||   :::.||..| |...::|||.                 |::.::         |:.  
Zfish  2211 IKKFN---IEETVKTLA-DTLKSILTPVTELVDKAINYLKTTEAKEIIEDLNNCLNHCIKYIR-- 2269

  Fly  2183 IELDDNAY------------------------KGNISAVTAHTHL---SMAASIENEDNFLETSV 2220
             ..|.||:                        :..:.|:....:.   ||:|.||..:......|
Zfish  2270 -SFDYNAFVDEANQKIKKLTNDLYTMSLSLEIRQKLEAIREFVNYALSSMSACIEKLEKVKVVDV 2333

  Fly  2221 ----------GIQLETDAIPHYGCQVYFKKDFSAVDKAIDIRFEV-------------------- 2255
                      .:.::|:|:         .:|...:...||||.|:                    
Zfish  2334 VKKFSDIVDSVVFIDTEAL---------IEDLRKILADIDIREEIQKFLKHASSISTKVVTTATD 2389

  Fly  2256 -------------TDNGTLNQLHISTDWHTDPSYIVNANGRIKTTMLPLQMASTSVLVIQGQNPH 2307
                         .|...:|:|....|             |:||.   |:.|...:       |.
Zfish  2390 ACSAVMQVIQNILKDQAVVNELKQICD-------------RVKTV---LRTAEFKI-------PS 2431

  Fly  2308 LNFDLNLLSQNGQSIAYGARANKKKDVFNIEVWTPMKNFRNISMHGTAIRSPRDPGRYDVSGF-- 2370
            ..|.|.                   |:....:...:||.:.|::..:.|         |:.||  
Zfish  2432 FIFPLT-------------------DLVVPSIKISLKNLQEINLPSSLI---------DLPGFTI 2468

  Fly  2371 ----------------------LYRNMATYEVTGAV-RMTNSLPI----DVVLRVQPKAGGRDGV 2408
                                  |...:|.:|:..|| .:...|.|    |:.....|:.    .:
Zfish  2469 LQYYTVPPIRVEYADIKQGLLDLLHFIANFEIMPAVENIFGDLRIVYMPDISAITLPEI----SL 2529

  Fly  2409 IELNIHEAGPKKI-RFSFSAIEDGKMCQMSGGYSVSKTNGAMDFSVLVESTEPEIARINFYGNLS 2472
            .|:::.|. ||.| :..||                             :.|.||.........:.
Zfish  2530 PEISLPEI-PKYISKHKFS-----------------------------DLTIPEFTLPGVPTEVM 2564

  Fly  2473 PNSEGSLVGDLSLETPWKALGIDTVHLHSDVGFLNKG---------GHIV----GEYKIGQYIGR 2524
            ....|.|.|::.:..|       ..::.:.|.|||..         |||.    .||.:.:|...
Zfish  2565 VPCFGKLYGEVRVTIP-------IFNMRTTVEFLNSTESAETPQFVGHITSHGSSEYDLLKYTLD 2622

  Fly  2525 GSC------LWSWILAEDMQLVLENYLERPNAKPRIVHASAKYQNPGQTFTQLQAGGRLSVDSKW 2583
            .:.      :...||||.:               :|.|:.                  |::|.:.
Zfish  2623 STARVAMPKMSRVILAETL---------------KITHSV------------------LAIDHQS 2654

  Fly  2584 NLDVNG-SAEYKSVDDFKFRVITALPLPVGDRHQLSASYQGNVISQQFNNPDFVL--------EA 2639
            ::.:.| ||:..|....|   ||            |::|..|:::..|    |.|        :.
Zfish  2655 SVSLYGLSAQASSKSTMK---IT------------SSTYNANIVNTAF----FALAGGISANIKT 2700

  Fly  2640 SYESFEAQNKLLSRISYKN----ATNNLKGLGHVEWGKIQNLSVVEGDFELLHKQGAQREFSAKI 2700
            :|......:...|...|.|    ..:.||.|..:|.....::||:|...::..|..     |:.|
Zfish  2701 TYNDKLNADLWNSEYYYGNDIILKQDGLKLLLTMEEEAKGHISVLEKSDDITGKSS-----SSII 2760

  Fly  2701 ITPKFKNEHTFALTGSYDLEKSGHHNVVGSL----------DYPASRRIT--------------- 2740
            |||.     ||:|..|.| ..|...|:..|:          |:.||...|               
Zfish  2761 ITPT-----TFSLIISVD-SSSSVSNIKKSIKADGVALSYVDFTASIEGTSDSELFLLNAAGKAD 2819

  Fly  2741 ----------DLDVSVSSLSNMHGIFNSTLPTFLNVSWLKTDFNFTTNNGKSYRYCRCFWPQDTA 2795
                      |||...:.|  :.|.|.|.             |||...            |.:..
Zfish  2820 LRQMKVEMKADLDTKYAGL--LSGTFTSA-------------FNFLVQ------------PFEVV 2857

  Fly  2796 YFKLNSNYDSDSSNFNHNLNGNVEIEVPLATRHRADIVYGLQKRRNQDAGNVKVVYN--EKQVLD 2858
            .            :|.:..|..:.:..||:.:      ..||       .|..|:.|  |:.:..
Zfish  2858 L------------DFKNKANTKLNLVEPLSAK------IDLQ-------NNYTVILNSDEQMLST 2897

  Fly  2859 GKYKRLEQAKAPIYKETTDISLENEVKPLGIHFVSTRDA---------SDPAGSQD--VKHIEIY 2912
            |...|..|     ||.:.:.:|.|.....||:.....:|         |.||...:  ...|||.
Zfish  2898 GLLARFNQ-----YKYSHNFTLANNEDEAGIYAAVNGEANLEFLTIPFSIPAMELETLTMVIEIP 2957

  Fly  2913 ELRNTQNFNLTG-----------------------ELHSRATLKAQDFKVVA------------- 2941
            |:.|...:..||                       :|.|..:.|:..|.:.|             
Zfish  2958 EISNINLYEQTGLKHVLTDFDQAIDVDAKMVYQKNDLTSELSFKSSIFNLNANAGFYQKDNPVIR 3022

  Fly  2942 ---IHPNRAVVLSTKYEDVSPEVVRHHSKLELS-------------ETAWIGYNLELGNFSKVGN 2990
               |..:....|..|.|..|....:...||..|             .||    .:.|.||    .
Zfish  3023 FGVITASEFESLKAKLEGTSSLSTKSGFKLANSLLLENRHIEGTHESTA----TMNLNNF----E 3079

  Fly  2991 ESQSFALEIFYPKRN---LSSSGQYYMT---DTNFNSDLSFQWLGGNYDQQPKIIHSNLQWKAEP 3049
            .:.|.|.:   .|.|   |:::..:.:|   ..|..:|.:|:.   :|:....||....:..||.
Zfish  3080 VTLSMATD---AKMNLPILTANANHQLTADNKANPKADSTFKM---DYNFDVPIIKLVGKGNAET 3138

  Fly  3050 LHRGDREHRTIALTVAHPLLEKDIN--------CKAT-------YYRG--LRDLLRT--HLTIDY 3095
            :.:|:.....|:   |..|::.:|:        .|.|       |..|  ||..|:|  :..::|
Zfish  3139 ILKGEGTRTFIS---AETLIKSNIDGTFLDRGILKGTLNYDESLYVNGNSLRYALKTGGNGDLNY 3200

  Fly  3096 SEYP-----DQLIELGAQLTDRYSELGHTNY------TFHVYGKHIA-SELDVQLNGTLAAMNSY 3148
            .::.     |:.:.:.......|:.:..|:.      :|:..|.|.: :.||:.|..:|      
Zfish  3201 GDFKVAFDVDENLSVETANEHVYATMKFTSNNEANVGSFNTKGVHSSQATLDMALLKSL------ 3259

  Fly  3149 YKTESTAHYKRDIF-PARYGKFLALLDVNKRELEYERQSPFHAVRLHLLPTIRYPIYGLNATI-- 3210
                 .|..|.|:. |:.:|: |::.:..|.:|...:|      ::.:|.||:.|:|..:...  
Zfish  3260 -----VADMKIDLSQPSTFGE-LSIFETMKVDLSAPKQ------KIDILSTIKSPVYTTDVRAKL 3312

  Fly  3211 -WDTPDTNHSGYIYMDILERYA-----RMDFNLTEDASQNLQ----MVGYIPDTRSAFLDIWRNY 3265
             .:.||       |..:|:..|     |:.::|....|..::    :||     .:|.|    .:
Zfish  3313 DGNAPD-------YKTVLKASATSPVVRLQYDLDSSMSSTMENGALVVG-----ANAVL----TH 3361

  Fly  3266 EEIRVIDVSSYLKMN-HSRL----ITGRFHWRPSIRQEVREKIQAVGKSVYSSFSEGIDFWIKSI 3325
            ::. .:|:|:.::|: .|.:    ||.:.....::|              |::.|:||.   .|:
Zfish  3362 QDF-TMDISNAIRMSERSHILNVDITSQTFTDVNLR--------------YAARSDGIS---GSV 3408

  Fly  3326 YTETTESMG--VVWNTAKEYNRDFI--------DDIGQLSVLEEDLADLR-LFVNQSYEANDFYI 3379
            .|..:..:|  :..|...:.|....        ||:..|||......|.: |.|..:.:|.....
Zfish  3409 STPGSGLLGFQLQGNIPSQMNARLYCRYAFAPDDDVDILSVRAVPKGDEKVLLVTGNIKAAQSMF 3473

  Fly  3380 KNVVNFTLTILDELAIRDHIESLPKIFSELWQAMGDSGKALRNSIVWLIETIKTTYNNLLDAVAR 3444
            :.::|                :|.||..:|.....:.|.|..   :::.:.:....:|.|.|..|
Zfish  3474 EGLMN----------------TLEKISFKLAGLAREYGLAFP---IFVADDVYGVISNGLSAARR 3519

  Fly  3445 FFHGESLVYISGLLEKGIAKYDSFIKDLHIKFIKYIENLWHKTWTLAENHWKAVLKRFEPHLFKM 3509
                         ...|:::.....:::.:...|.|:       .|.:|   |::...|...:|:
Zfish  3520 -------------ATPGVSELSQLFRNVVVTSQKTIQ-------VLIDN---AIVLVKEISQYKL 3561

  Fly  3510 ISFIETTAWNLSKE----VFDFIYKRTNELAESPYFNKVSSFTADAERLYRDFKANDAITNIKKY 3570
            ....|.|...:.|:    |.:.:....|.|  ..||:.:                      :..:
Zfish  3562 PGMNEATLAEICKKIQLVVVEMLRNFGNNL--EVYFSPI----------------------MDNF 3602

  Fly  3571 STIAWNFVKEKYFKLVPFGAELNEVLTE----IWQEIKELEKIDQV-QIMVQKYYEVMAKVDWVA 3630
            :||...|...|...:..|...:..:|..    |...:|::|..|.| :.:.|...||:.|.....
Zfish  3603 NTIQLTFPNGKVMTVAEFQQNVQSILRSNLVMIADAMKQIESPDVVLKKLGQTLQEVVEKGQEFV 3667

  Fly  3631 DELQLEHRLHQVYGLVRNKFRNYAMNALETADMYREAKTKFVFD---PEVGIIDLEQKLPMSWHA 3692
            |::.|. .|..:...: |.|....|..:|      :.....:|.   |.:.|.::.|.:....:|
Zfish  3668 DKMNLS-LLEDIAAAI-NTFYQELMKIIE------DISEAVIFGFSIPAIKIYEISQNIGKVLNA 3724

  Fly  3693 FNETPRFE-EIPEYQ 3706
            .|...:|| .:|.:|
Zfish  3725 NNGIHQFELPLPFFQ 3739

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 120/631 (19%)
DUF1943 665..1012 CDD:286281 83/366 (23%)
DUF1081 1029..1122 CDD:283982 21/96 (22%)
VWD 3741..3908 CDD:295339
C8 3951..4014 CDD:285899
apobb.1XP_005160686.1 Vitellogenin_N 32..579 CDD:279663 121/635 (19%)
DUF1943 613..912 CDD:286281 83/363 (23%)
DUF1081 934..1016 CDD:283982 22/104 (21%)
EzrA 1921..2312 CDD:283753 72/425 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128722
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.