DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and vtg3

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:NP_571340.1 Gene:vtg3 ZFINID:ZDB-GENE-991019-2 Length:1253 Species:Danio rerio

Alignment Length:1277 Identity:247/1278 (19%)
Similarity:448/1278 (35%) Gaps:377/1278 (29%)


  Fly    52 YKYQYTVAVRTEFAGSGDNSSDLLLKSDLEIFFPKPCEGYLRINDAKLYDTLDELNDNESDSSEK 116
            |||:..|.|..|.....:  |.|.|:...:|....|....|::::.                   
Zfish    32 YKYEGLVQVGRELPHLVE--SALKLRCTFKIIGESPHTFVLQVSNV------------------- 75

  Fly   117 TKEYDYYDNLANEE--SESQNYDNMHPKSSDFNVDLTKNL-------LRFAFHDGLISEVCPQEQ 172
              :::.::.:..:.  |.|:|              :||:|       :.|.:..|.|:::.....
Zfish    76 --DFEDFNGIPGKSVFSPSKN--------------ITKHLSAEISQPIIFEYSKGQITDIRTAPG 124

  Fly   173 ETPWVLNIKKGILSAFQNTMMRFDVDANTTETDVSGQCQVQYAL-EDTDSSYVTIRKTKDINSCR 236
            .:..|:||.:|||...|.|:..........|..:.|.||..|.: ||:::..:.:.:..||.:|:
Zfish   125 VSNTVVNIVRGILGFLQVTVKTTQSFYELIELGIHGLCQSSYTVDEDSNAKELIVTRIVDITNCQ 189

  Fly   237 Q-----------------RYATHSVLQTTPYTFRDDKTIWPILKSQSHCNLTIDNNVYKEIKCLE 284
            |                 :....||:.|..:|:        .:||      |.|.....:....|
Zfish   190 QPASLYRGMALAPEDKLSKQRGESVVSTVKHTY--------TVKS------TADGGQITKAFAQE 240

  Fly   285 THLLVPFSNASSGALTTSTSR----LKL-DGVESYSAGEFLEQNPELVERRATLVFDHTPAVKP- 343
            .....|| |...|.......|    ||: |..:....|:        |:.|..|::.....:|| 
Zfish   241 RQYFSPF-NVKGGNFRMLALRDIELLKVSDTTDKVVTGQ--------VQSRGNLMYKTNKDLKPI 296

  Fly   344 ------SHDEIKAARELLVEMCRVGFPNIQREFIDVFTNFLQTSKSLDYKTLSVL--LQRSASTC 400
                  .:|.:....:|:..:.:....::..|   ..|..|...:.:...||..|  |.:..|..
Zfish   297 PVVMLNLNDPVPKILDLIKRLAQANIYHVDSE---TSTEILDLIQLMRVTTLDNLEHLWKQVSGN 358

  Fly   401 EQGRNHLLE---------SLPFIGSTASYK--------------VMRDQIINEKLTKQMAHDWMT 442
            ::.|...|:         .|.|:  .|.||              |..:.:..|.::..:|.:   
Zfish   359 DEHRRWFLDLVVEVTDERILKFL--EARYKAGDITANEAGQALVVAFNHLSAEPVSVALAQE--- 418

  Fly   443 ALSFITRPDEETLETFHSILEYAKNRLDAEYTLGATAVVHSFCKHHEACEENLRVQQIINLLETE 507
               |:|.|..::    |.:|...       ..|...::||.:|.:.:.|...: ||.::|:..:.
Zfish   419 ---FLTIPFSKS----HPLLWNT-------VVLAYGSLVHRYCVYTDPCPITV-VQPLLNMAASS 468

  Fly   508 FLNLYNLFKGERRTRERMVILLKGLGNIGVVSSAFAEQLQWI--IREDEAPVDIRLHG--ILAFR 568
            .         .:.:.:.||:.||.|||...:|| |...|:::  .......:..|:.|  :.|||
Zfish   469 L---------SKNSEDEMVLALKSLGNAAHLSS-FKTLLKFLPGYSNGAEKLSTRVQGAAVQAFR 523

  Fly   569 RV-DCARH--RSYFLDNYGNYTLNSELRIYSYLQAMRC-PDYISVGVIKSILEHEEINQVGSFVW 629
            .: ..|.|  :...|:.:....|.:|:|:.:.:..:.. |....:.|:..:|..|...||.||.:
Zfish   524 LLASRASHSVQDIVLNLFVQKHLPAEIRMLACIVLLETKPSTALISVVSEVLLEEADLQVASFSY 588

  Fly   630 SHLTNLAKSNSPVRIEAQGLLLNDELSERFKMDIRK-------FSRNYEHSLFFDEYNFGTTTDA 687
            |.|...|||.:|   :.|.|.:...::  .|:..||       :|:|.....|.|::.|||:.|.
Zfish   589 SLLK
GFAKSRTP---DNQHLSIACNIA--MKILTRKLGHLSYRYSKNLHFDWFHDDFLFGTSADV 648

  Fly   688 NVIFGTDSYLPRIASVNFTADLFGQSVNFFEFTARAEGLEELAANAFGPKGPLSGQLLRKKLSFL 752
            .:: ..:|.:|....:.......|:.:.|.||..||:||::|.|.               |:..|
Zfish   649 YML-QNESPIPTKLMLKGKFHFIGRILQFLEFGIRADGLKDLFAG---------------KIPEL 697

  Fly   753 NRWLGNESAEEDDTLENLLSLDNLRLKRKAQEQARASEEEVDEDYDFEESLEGNKRQKRDVSTTR 817
            .:.||         :.:|.|:    ||..:..|:...::.:...|                    
Zfish   698 TKDLG---------ISDLASI----LKILSNWQSLPKDKPLLTAY-------------------- 729

  Fly   818 KQEIDRNVDSLGYKLKYDYNNPRAQFGLRVFGNDLRYFNVESLVEVMALAAKFNP--------FQ 874
                                       .||||.:....:| |...|.::...|:|        ::
Zfish   730 ---------------------------ARVFGQEAFLMDV-SRDSVQSIIKSFSPSAGKESKVWE 766

  Fly   875 QAKNVLSGKEFTYTKSRVFLDASYTVPLAVGLPLAIHAFGA--SSIDLRVSGNLDEMDPPTDWHF 937
            :.::|..|..:.:||..:..:|.:..|..:|||:.|..:.:  :::.::...   |::||...|.
Zfish   767 RIQDVQKGTSWHWTKPHLVYEARFIQPTCLGLPVEISKYYSVVNAVTMKAKA---EINPPPKEHL 828

  Fly   938 ------DVEGQFKPSVSVD----VITTMQTDMFWEQSGIKVKSNLYSNSELVAKLKVRGRNLVSF 992
                  |:..|....:.|.    :...:.||:|  |.|.::||.:.........||:..:. .::
Zfish   829 GELLSSDISMQTDGFIGVTKDHFLFHGINTDLF--QCGTELKSKVSMGLPWAFDLKINPKE-QTY 890

  Fly   993 SFDLPRDKN--EIFSVRS---------------------------------ELLVQKREEQLPQA 1022
            ..:|...|:  |:|||.|                                 .:|...|:||..::
Zfish   891 EMNLTPSKSVTELFSVSSNVYAVLRNIEDPTSSKITPMMPETGESWQGVPLRMLPPLRDEQTKKS 955

  Fly  1023 GIANRSANSTCTWPVLDQAIGLQMC-------SHYSVPDLSNATEIYPSLLLAGPLNFSLILKKS 1080
            |:..|.....       :..|..:|       :||        ...||...|.|..:||..|:.:
Zfish   956 GMKFRQCAEA-------KIYGTALCIEAEAKRAHY--------LHEYPLYYLLGDTHFSYSLEPA 1005

  Fly  1081 -----------DLSAKKY--------------VFEYKWDQQEEDNNFSLVFTTPGSKVPRVLVAN 1120
                       .:||.:.              ||     ::..|.|.|.......|.:|.....:
Zfish  1006 KDAKPIEKIQIQVSASRQHPSVMSGMVNLNQRVF-----KETRDENTSCEERKTSSSLPVTQDLD 1065

  Fly  1121 VTKVPDAFNASVAFVNGPNRVSAGCSYDGNPDFRRLDIYLDT 1162
            ||  ||......|....|.....|  |:|      :..||.|
Zfish  1066 VT--PDPVVTVKALSLSPQAKPLG--YEG------VAFYLPT 1097

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 128/653 (20%)
DUF1943 665..1012 CDD:286281 74/409 (18%)
DUF1081 1029..1122 CDD:283982 21/125 (17%)
VWD 3741..3908 CDD:295339
C8 3951..4014 CDD:285899
vtg3NP_571340.1 Vitellogenin_N 24..592 CDD:279663 128/653 (20%)
DUF1943 626..912 CDD:286281 72/369 (20%)
DUF1944 1070..1238 CDD:286284 8/37 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23345
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.