DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and vit-3

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:NP_001294839.1 Gene:vit-3 WormBaseID:WBGene00006927 Length:1603 Species:Caenorhabditis elegans

Alignment Length:1597 Identity:306/1598 (19%)
Similarity:568/1598 (36%) Gaps:470/1598 (29%)


  Fly   149 DLTKNLLRFAF----HDGLISEVCPQEQETPWVLNIKKGILSAF-------------QNTMMRFD 196
            |..|.||...|    .:||:||:....::..|..|.|:.||:.|             ....|..|
 Worm   101 DELKELLELPFRAQIRNGLVSEIQFSSEDAEWSKNAKRSILNLFSLRKSAPVDEMSQDQKDMESD 165

  Fly   197 VDA---NTTETDVSGQCQVQYAL--EDTDSSYVTIRKTKDIN--SCRQRYATHSVL--------- 245
            .|:   |..|..:.|.|:|.|.:  |...:.|     ||.:|  .|..|..|...|         
 Worm   166 KDSLFFNVHEKTMEGDCEVAYTIVQEGEKTIY-----TKSVNFDKCITRPETAYGLRFGSECKEC 225

  Fly   246 ---------QTT-PYTFRDDKTIWPILKSQSHCNLTIDNNVYKEIKCLETHLLVPFSNAS----- 295
                     ||. .|||:::|    :.:|:.|...|::.|..:.:|. ||...|.|...|     
 Worm   226 EKEGQFVKPQTVYTYTFKNEK----LQESEVHSIYTLNVNGQEVVKS-ETRSKVTFVEESKINRE 285

  Fly   296 ----SG---ALTTSTSRLKLDGVES-YSAGEFLEQNP----ELVERRATL--VF-------DHTP 339
                ||   .:..|....||  :|. |..|:..|.||    |:.::...|  :|       .:||
 Worm   286 IKKVSGPKEEIVYSMENEKL--IEQFYQQGDQAEVNPFKAIEMEQKVEQLDEIFRQIQEHEQNTP 348

  Fly   340 AVKPSHDEIKAARELLVEMCRVGFPNIQREFIDVFTNFLQTSKSLDYKTLSVLLQRSASTCEQGR 404
              :..|...:|.|  :..||.:  ..:::....::|...:..:.:...||:|     |.| :...
 Worm   349 --ETVHLIARAVR--MFRMCTI--EELKKVHTTIYTKAEKKVQLVIETTLAV-----AGT-KNTI 401

  Fly   405 NHLLESLPFIGSTASYKVMRDQIINEKLTKQMAHDWMTALSFITRPDEETLETFHSILEYAKNRL 469
            .||:....                .:.:|...|.:.:.::.....|.|...:.   :::.|::.|
 Worm   402 QHLIHHFE----------------KKSITPLRAAELLKSVQETLYPSEHIADL---LIQLAQSPL 447

  Fly   470 DAEYT-------LGATAVVHSFCKHHEACEENLRVQQIINLLETEFLNLYNLFKGERRTRER--- 524
            ..:|.       |.|.:||..|..                  :|:.|.|  :....|:|:|:   
 Worm   448 SEKYEPLRQSAWLAAGSVVRGFAS------------------KTQDLPL--IRPASRQTKEKYVR 492

  Fly   525 --------------MVILLKGLGNIGVVSSAFAEQLQWIIREDEAPVDIRLHGILAFRRVDCARH 575
                          .|:.||.|||.|:..|.:  :|..:|::...|:.||...:.|.|.:.....
 Worm   493 VFMQHFRNADSTYEKVLALKTLGNAGIDLSVY--ELVQLIQDPRQPLSIRTEAVDALRLLKDVMP 555

  Fly   576 R---SYFLDNYGNYTLNSELRIYSYLQAMR-CPDYISVGVIKSILEHEEINQVGSFVWSHLTNLA 636
            |   ...|..|.|.....|||:.:..:.|. .|:...:..|.|.:|:|....|.:|.::.|...:
 Worm   556 RKIQKVLLPVYKNRQNKPELRMAALWRMMHTIPEEPVLAHIVSQMENESNQHVAAFTYNVLRQFS 620

  Fly   637 KSNSP----VRIEAQGLLLNDELSERFKMDIRKFSRNYEHSLFFDEYNFGTTTDANVIFGTDSYL 697
            ||.:|    :.:....:|    |..|::...:..|...:..||..|:..|...|...||..:::|
 Worm   621 KSTNPCYQQLAVRCSKVL----LFTRYQPQEQMLSTYSQLPLFNSEWLSGVQFDFATIFEKNAFL 681

  Fly   698 PRIASVNFTADLFGQSVN--FFEFTARAEGLEELAANAFGPKGPLSGQLLRKKLSFLNRWLGNES 760
            |:....:|.. :||.:.|  |.:.....:..|               |::.|.|..|:.: |.:|
 Worm   682 PKEVQASFET-VFGGNWNKYFAQVGFSQQNFE---------------QVILKTLEKLSLY-GKQS 729

  Fly   761 AEEDDTLENLLSLDNLRLKRKAQEQARASEEEVDEDYDFEESLEGNKRQKRDVSTTRKQEIDRNV 825
                         |.|| .|:.|...:..:|.|               :|.::....:|...:|.
 Worm   730 -------------DELR-SRRVQSGIQMLQEIV---------------KKMNIRPRVQQTDSQNA 765

  Fly   826 DSLGYKLKY---DYNNPRAQFGLRVFGNDLRYFNVESLVEVMALAAKFNPFQQAKNVLSGKEFTY 887
            .::.| |:|   ||         .|...|:.  .::::||......:|:.......:.:..:|..
 Worm   766 HAVFY-LRYKEMDY---------IVLPIDME--TIDNVVEKYVRNGEFDIKSLLTFLTNDSKFEL 818

  Fly   888 TKSRVFLDASYTVPLAVGLPLAIHA--------FGASSIDLRVSGNLDEMDPPTDWHFDVEGQFK 944
            .::..|.:|...:|..:|:||.|..        .|..||:|...|....:|            ..
 Worm   819 HRALFFYEAERRIPTTIGMPLTISGKMPTILSINGKVSIELEKLGARLVLD------------IV 871

  Fly   945 PSVSVDVITTMQTDMFWE---QSGIK--VKSNLYSNSELVAKLKVRGRNL-VSFSFDLPRDKNEI 1003
            |:|:...:|.|:   ||.   :.|:|  ..:.|::.....:.::::...| ::..|.:|.:|...
 Worm   872 PTVATTHVTEMR---FWYPVIEQGVKSLQSARLHTPLRFESTVELKKNTLEITHKFVVPENKKTT 933

  Fly  1004 FSVRS-----------------------------ELLVQKREEQLPQAGI-ANRSANSTCTWPVL 1038
            .||.:                             ::..::.:.|....|: .|...|....| .|
 Worm   934 VSVHTRPVAFIRVPKNQDSEYVETEEKTISHSQYQMSTEEIDRQYETFGLRINAQGNVLSQW-TL 997

  Fly  1039 DQAIGLQMCSHYSVPDLSNATEIYPSLLLAGPLNFSLILKKSDLSAKKY--VFEYKWD-QQEEDN 1100
            ...:..:....:::.:.:...|....:.:..       |:|:|||..|:  :||.::| :..|..
 Worm   998 PMVLMTEQDFEFTLENKNRPVEFTARVTIGN-------LEKTDLSEIKFDKIFEKEFDLENNESE 1055

  Fly  1101 NFSLVFTTPGSKVPRVLVANVTKVPDAFNASVAFVNGPNRVSAGCSYDGNPDFRRL-DIYLDTNG 1164
            |....|        ..::..:.......|.....:..|.::.      .|.:.|.: |.::    
 Worm  1056 NRRQYF--------HKMIREIQSEQGFKNLITLKLEAPQQMY------WNTELRTVCDKWI---- 1102

  Fly  1165 NRSLDLGMELRR----HQDFTAWIYNPRMLLAINGVNITGLAGTVKVNEKNGIKQ------HDVD 1219
             |...:.|:.||    |:: ..|.....:|.|             :....:.::|      .:|.
 Worm  1103 -RMCKVEMDARRSPMEHEN-KEWTLRTELLAA-------------RPQMPSSLRQLREQPHREVQ 1152

  Fly  1220 LSFETKKLQAVIKGNVVQSEITTSTNMTIKYRFQANKIEEINFAGKLVNNGDKSKTEYRG----N 1280
            |:...|      .|:..:||||          |.| ::|:.....|.:.|.::   ||:|    .
 Worm  1153 LALNAK------WGSSKKSEIT----------FNA-QLEQSTEQKKFLRNIER---EYKGIPEYE 1197

  Fly  1281 MKLQTSAYPKLNFASESTWLSLQGHTEGMITYNNAPDYVNP-NYTSLVRLIFARSHSEDSFLDGT 1344
            :.::.:...::|..||   ..|...:|  .|::...|.:.. |:.::..   .|..:||      
 Worm  1198 LLIKAARLNQVNVVSE---YKLTPESE--YTFSRIFDLIKAYNFWTVSE---KRVQNED------ 1248

  Fly  1345 QTRASLELKL-PRSKIDYRILVKHKEHIKNGTEHNVIVGLKYTPEKEITGLFSVHLPRRNLFAID 1408
             .|..|:|.: |.|:....:.::                   |||:|:. |.:|.:||       
 Worm  1249 -RRVVLQLSVEPLSRQYMNMTIQ-------------------TPEQEVE-LKNVRIPR------- 1285

  Fly  1409 AYMNVTVP------------EFNSCTASLKVNEKATKDYIIFINGSWFTGHSVAVKANYKDRSSR 1461
                |.:|            |....|..:..:|.:|.|.:|: .....|.:|:..    ||.|  
 Worm  1286 ----VVLPTIARRAMFQQTWEKTGATCKVGQSEVSTFDNVIY-RAPLTTCYSLVA----KDCS-- 1339

  Fly  1462 VQALHHLKMIVESPSFNITSLNIIYRRKQLLIFY-----DIQAKYDQDPYGLTIQYASNAHNRNT 1521
                       |.|.|.:.:..|....::||:..     :|..|...|.:.:.:.          
 Worm  1340 -----------EQPRFAVLAKKINKNSEELLVKVVRREEEIVVKKSDDKFLVKVD---------- 1383

  Fly  1522 NAEVRLKVKERDYWINAKLLSEQPKLLQL---EIHMD 1555
              |.::...|.:.: |.::|.:...:::|   |:..|
 Worm  1384 --EKKVNPTELEQY-NIEILGDNLIVIRLPHGEVRFD 1417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 127/581 (22%)
DUF1943 665..1012 CDD:286281 71/395 (18%)
DUF1081 1029..1122 CDD:283982 16/96 (17%)
VWD 3741..3908 CDD:295339
C8 3951..4014 CDD:285899
vit-3NP_001294839.1 Vitellogenin_N 24..617 CDD:279663 127/581 (22%)
DUF1943 651..942 CDD:286281 71/364 (20%)
VWD 1300..1454 CDD:214566 27/150 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23345
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.