DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and Apob

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:NP_033823.2 Gene:Apob MGIID:88052 Length:4505 Species:Mus musculus

Alignment Length:4936 Identity:898/4937 (18%)
Similarity:1610/4937 (33%) Gaps:1635/4937 (33%)


  Fly     1 MGGLKPQ-----AAIWLLLLIAHTQAVRENPLKDPRICGRPQCDSKSAKFNYGEQLYKYQYTVAV 60
            ||..||.     ..::|||.:..:...::..|::...    .|...:.:|.:..: |.|.|....
Mouse     1 MGPRKPALRTPLLLLFLLLFLDTSVWAQDEVLENLSF----SCPKDATRFKHLRK-YVYNYEAES 60

  Fly    61 RTEFAGSGDNSSDLLLKSDLEIFFPKPCEGYLRINDAKLYDTLDEL---NDNESDSSEKTKEYDY 122
            .:...|:.|:.|...:...:|:..|:.|...:|.|..    ||.|:   |.......:|||    
Mouse    61 SSGVQGTADSRSATKINCKVELEVPQICGFIMRTNQC----TLKEVYGFNPEGKALMKKTK---- 117

  Fly   123 YDNLANEESESQNYDNMHPKSSDFNVDLTKNLLRFAFHDGLISEVCPQEQETPWVLNIKKGILSA 187
                               .|.:|...:::..|:.|..:|....:.|.:.|..::||||:||:||
Mouse   118 -------------------NSEEFAAAMSRYELKLAIPEGKQIVLYPDKDEPKYILNIKRGIISA 163

  Fly   188 FQNTMMRFDVDANTTETD-------VSGQCQVQYALEDTDSSYVTIRKT-KDINSCR--QRYATH 242
            ..       |...|.|..       |.|.|..|..:.....:..|...| :::..|.  |..:| 
Mouse   164 LL-------VPPETEEDQQELFLDTVYGNCSTQVTVNSRKGTVPTEMSTERNLQQCDGFQPIST- 220

  Fly   243 SVLQTTPYTFRDDKTIWP---ILKSQSHCNLTID--NNVYKEIKCLETHLLVPFSNASS-GALTT 301
               ..:|...... .:.|   ::.|...|..|:|  .....|..|.|.||.:|||..:. |.:|.
Mouse   221 ---SVSPLALIKG-LVHPLSTLISSSQTCQYTLDPKRKHVSEAVCDEQHLFLPFSYKNKYGIMTR 281

  Fly   302 STSRLKLDGVESYSAGEFLEQNPELVERRATLVFDHTPAVKPSHDEIKAARELLVEMCRVGFPNI 366
            .|.:|.|:.....::..|.|..     .|..|.|:.|.:.. |..:..|..:.|.|:.::.....
Mouse   282 VTQKLSLEDTPKINSRFFSEGT-----NRMGLAFESTKSTS-SPKQADAVLKTLQELKKLSISEQ 340

  Fly   367 QREFIDVFTNFLQTSKSLDYKTLSVLLQRSASTCEQGRNHLLESLPFIGSTASYKVMRDQIINEK 431
            ..:..::|...:...:.|..:.::.||.:   ..|......|::|...|....|..:...:..||
Mouse   341 NAQRANLFNKLVTELRGLTGEAITSLLPQ---LIEVSSPITLQALVQCGQPQCYTHILQWLKTEK 402

  Fly   432 LTKQMAH----DWMTAL-SFITRPDEETLETFHSILEYAKNRLDAEYTLGAT--AVVHSFCKHHE 489
                 ||    |.:|.| :.|..|..:.|:...:..:..::|        ||  |:.|:...:.:
Mouse   403 -----AHPLLVDIVTYLMALIPNPSTQRLQEIFNTAKEQQSR--------ATLYALSHAVNSYFD 454

  Fly   490 ACEENLRVQQ-----IINLLETEFLNLYNLFKGERRTRERMVILLKGLGNIG----VVSSAFAEQ 545
            .......|.|     ::..::.|...          ..:...::|:.:||:|    .|..|....
Mouse   455 VDHSRSPVLQDIAGYLLKQIDNECTG----------NEDHTFLILRVIGNMGRTMEQVMPALKSS 509

  Fly   546 LQWIIREDEAPVDIRLHGILAFRRVDCARH-RSYFLDNYGNYTLNSELRIYSYLQAMRCPDYISV 609
            :...:|..:..:.|:...:.|.|:::.... |:...|.:.|.....|.|:.:||..|:.|....:
Mouse   510 VLSCVRSTKPSLLIQKAALQALRKMELEDEVRTILFDTFVNGVAPVEKRLAAYLLLMKNPSSSDI 574

  Fly   610 GVIKSILEHEEINQVGSFVWSHLTNLAKSNSPVRIEAQGLLLNDELSERFK--MDIRKFSRNYEH 672
            ..|..:|:.|:..||.:||.||:.|:..|......:.:.|:.|...:.:|.  ||.|||||||:.
Mouse   575 NKIAQLLQWEQSEQVKNFVASHIANILNSEELYVQDLKVLIKNALENSQFPTIMDFRKFSRNYQI 639

  Fly   673 SL-----FFDEYNFGTTTDANVIFGTDSYLPRIASVNFTADLFG-QSVNFFEFTARAEGLEELAA 731
            |.     .||..:  ...:.|:||...|||||.:.:..|..:|| .|::.||.....:|.|....
Mouse   640 SKSASLPMFDPVS--VKIEGNLIFDPSSYLPRESLLKTTLTVFGLASLDLFEIGLEGKGFEPTLE 702

  Fly   732 NAFGPKG--PLSGQLLRKKLSFLNRWLGNESAEEDDTLENLLSLDNLRLKRKAQEQARASEEEVD 794
            ..||.:|  |.|   :.|.|.::|       ....|.:..:|                     ||
Mouse   703 ALFGKQGFFPDS---VNKALYWVN-------GRVPDGVSKVL---------------------VD 736

  Fly   795 EDYDFEESLEGNKRQKRDVSTTRKQEIDRNVDSLGYKLKYDYNNPRAQFGLRVFGNDLRYFNVES 859
            .   |..:.:|  :.::|:.......:|:.:..|..|     ..|.|:..||:.|.:|.:..::.
Mouse   737 H---FGYTTDG--KHEQDMVNGIMPIVDKLIKDLKSK-----EIPEARAYLRILGKELSFVRLQD 791

  Fly   860 LVEVM-------ALAAKFNPFQQAKNVLSGKEFTYTKSRVFLDASYTVPLAVGLPLAIHAFGASS 917
            | :|:       |...:..|....:.:..|.:.......:|:|.::.:|...||.|.:.:.|..:
Mouse   792 L-QVLGKLLLSGAQTLQGIPQMVVQAIREGSKNDLFLHYIFMDNAFELPTGAGLQLQVSSSGVFT 855

  Fly   918 IDLRVSGNLDEMDPPTDWHFDVEGQFKPSVSVDVITTMQTDM-FWEQSGIKVKSNLYSNSELVAK 981
            ..::....|:..      :...|...|||||::.:|.|...: .:.:|.:::.:|.:..|.|.|:
Mouse   856 PGIKAGVRLELA------NIQAELVAKPSVSLEFVTNMGIIIPDFAKSSVQMNTNFFHESGLEAR 914

  Fly   982 LKVRGRNLVSFSFDLPRDKNEIFSVRSEL-LVQKREEQLPQAGIANRSANSTCTWPVLDQAIGLQ 1045
            :.::...| ......|:...::||..:.| ||...:.::....:.||.:.|||. |:.   .|:.
Mouse   915 VALKAGQL-KVIIPSPKRPVKLFSGSNTLHLVSTTKTEVIPPLVENRQSWSTCK-PLF---TGMN 974

  Fly  1046 MCS--HYSVPDLSNATEIYPSLLLAGPLNFSLILKKSDLSAKKYVFEYKWDQQEEDNNF--SLVF 1106
            .|:  .||....:.:...||   |.|...:.|.|:.:. ..::|.....::..:||.:.  :|.|
Mouse   975 YCTTGAYSNASSTESASYYP---LTGDTRYELELRPTG-EVEQYSATATYELLKEDKSLVDTLKF 1035

  Fly  1107 TTPGSKVPRVLVANVTKVPDAFNASVAFVNGPNRVSAGCSYDG-NPDFRRLDIYLDTNGNRSLDL 1170
            ......|.:            ..|:|.|..  ||.|...|.:. .|.|       |.|      .
Mouse  1036 LVQAEGVQQ------------SEATVLFKY--NRRSRTLSSEVLIPGF-------DVN------F 1073

  Fly  1171 GMELRRHQDFTAWIYNPRMLLAINGVNIT--GLAGTVKVNEKNGIK--------------QHDVD 1219
            |..||.:.:........:::|.|....||  .|.|.:..::|...|              :.:|.
Mouse  1074 GTILRVNDESAKDKNTYKLILDIQNKKITEVSLVGHLSYDKKGDGKIKGVVSIPRLQAEARSEVH 1138

  Fly  1220 LSFETKKLQAVIKGNVVQSEITTSTNMTIKYRFQANKIEEINFAGKLVNNGDKSKT-EYRGNMKL 1283
            ..:.:.||...:..:......|.|..:|.:|   .|:|.|.::     |.|....| :...|..:
Mouse  1139 THWSSTKLLFQMDSSATAYGSTISKRVTWRY---DNEIIEFDW-----NTGTNVDTKKVASNFPV 1195

  Fly  1284 QTSAYPKL--NFA------------------------SESTWLSLQGHTEGMITYNNAPDYVNP- 1321
            ..|.||::  .:|                        :.:|||.:.  |.|:.......|::|. 
Mouse  1196 DLSHYPRMLHEYANGLLDHRVPQTDVTFRDMGSKLIVATNTWLQMA--TRGLPYPQTLQDHLNSL 1258

  Fly  1322 NYTSLVRLIFARSHSEDS-FL--DG----TQTRASLELKLP-----RSKIDYRILVKHKEHIKNG 1374
            :..:|:::..:..|..|: ||  ||    |..|..:.:.:|     :|..|    :|..|.::..
Mouse  1259 SELNLLKMGLSDFHIPDNLFLKTDGRVKYTMNRNKINIDIPLPLGGKSSKD----LKMPESVRTP 1319

  Fly  1375 TEHNVIVGLKYTPEKEITGLFSVHLPRRNL----FAIDAYMNVTVPEFNSCTASLKVNEKATKDY 1435
            ..:...||.              |||.|.:    |.|.....:.||       .|.|.:.:|..|
Mouse  1320 ALNFKSVGF--------------HLPSREVQVPTFTIPKTHQLQVP-------LLGVLDLSTNVY 1363

  Fly  1436 IIFINGSW---FTGHSV-----AVKANYKDRSSRV---------------------------QAL 1465
            ....|  |   :||.:.     :::|.|:.::..|                           .:|
Mouse  1364 SNLYN--WSASYTGGNTSRDHFSLQAQYRMKTDSVVDLFSYSVQGSGETTYDSKNTFTLSCDGSL 1426

  Fly  1466 H-----------HLKMIVESP------SFNITS---------LNIIYRRKQLLIFYDIQAK---- 1500
            |           |::....||      :|..:|         :::..::||.|...||:..    
Mouse  1427 HHKFLDSKFKVSHVEKFGNSPVSKGLLTFETSSALGPQMSATVHLDSKKKQHLYVKDIKVDGQFR 1491

  Fly  1501 ----YDQDPYGLTIQ------------------------------------------------YA 1513
                |.|..|||:.:                                                :.
Mouse  1492 ASSFYAQGKYGLSCERDVTTGQLSGESNMRFNSTYFQGTNQIVGMYQDGALSITSTSDLQDGIFK 1556

  Fly  1514 SNAHNRNTNAEVRLKVKERDYWIN----AKL---LSEQPKLLQLEIHMDKIRD------------ 1559
            :.|..:..|.|:.||......:.|    .||   .|.|..||:.| |....:.            
Mouse  1557 NTASLKYENYELTLKSDSSGQYENFAASNKLDVTFSTQSALLRSE-HQANYKSLRLVTLLSGSLT 1620

  Fly  1560 ---VHIQVGLLNVDK----RKELSLELKWDANRDPSQRLGLLAEYNSPGTKHYDGNLMITYPERT 1617
               |.:...:|..||    ..:.:|::..|         ||    ::..|.:...:.::...|..
Mouse  1621 SQGVELNADILGTDKINTGAHKATLKIARD---------GL----STSATTNLKYSPLLLENELN 1672

  Fly  1618 IHFGFNS-----FTGGPKYFGKVHASWSIN------EV-IEFEYEAGILPGHTLHNWVKAELRTP 1670
            ...|.:.     .|.|  .|.:.||.:|::      || :...|:|.|| |....|....:|.. 
Mouse  1673 AELGLSGASMKLSTNG--RFKEHHAKFSLDGRAALTEVSLGSIYQAMIL-GADSKNIFNFKLSR- 1733

  Fly  1671 FDGWRVNSLDAGIYSLKNL-------ILVNSTLFWADDQKLQVG---YKSDYDVNDQLMSF---- 1721
             :|.|:::...|.|:...|       |...|..|::....:..|   ||.::::..|..||    
Mouse  1734 -EGLRLSNDLMGSYAEMKLDHTHSLNIAGLSLDFFSKMDNIYSGDKFYKQNFNLQLQPYSFITTL 1797

  Fly  1722 --DVRFGI-----NSTIRDIP-TINV-----------KVKHWMDVKKVDTELYLGYSGQNDTFNT 1767
              |:|:|.     |...|..| .:||           ::||...:...|.           ...:
Mouse  1798 SNDLRYGALDLTNNGRFRLEPLKLNVGGNFKGTYQNNELKHIYTISYTDL-----------VVAS 1851

  Fly  1768 YSMDSSWE---IEKNQRYN-NYSGLVHLVSPFKGYEKGGL----VAHFSLSDQRV-----VSGAA 1819
            |..|:..:   :|.:.|.| :..||...|.....|....|    |.||||:...:     .||..
Mouse  1852 YRADTVAKVQGVEFSHRLNADIEGLTSSVDVTTSYNSDPLHFNNVFHFSLAPFTLGIDTHTSGDG 1916

  Fly  1820 SLNF--------------DLREFTLTMNGYVKKFTDNML------------TVN-ITTPLEKFGT 1857
            .|:|              ......|.::...|..|.:.|            ||: :.||.|:..|
Mouse  1917 KLSFWGEHTGQLYSKFLLKAEPLALIVSHDYKGSTSHSLPYESSISTALEHTVSALLTPAEQTST 1981

  Fly  1858 INARFGLNEKKRHAVAEVRAPTAALGVEV--LADIK----------------NLLNFDVKLSVAT 1904
            ...:..||:|......|.......:|||:  .||:.                |:||   .|.|..
Mouse  1982 WKFKTKLNDKVYSQDFEAYNTKDKIGVELSGRADLSGLYSPIKLPFFYSEPVNVLN---GLEVND 2043

  Fly  1905 PIESFQQAAIFALFN------------------PERVD------------MRGLWNNVTLG-FT- 1937
            .::..|:..|.|:..                  |:.::            |||....:::. |. 
Mouse  2044 AVDKPQEFTIIAVVKYDKNQDVHTINLPFFKSLPDYLERNRRGMISLLEAMRGELQRLSVDQFVR 2108

  Fly  1938 -----------GVWHMQNITDFEYSYHVFTPLAGFEENGFIVQLLKRKEFVFQLHGKMSNYKL-- 1989
                       .:.|..|.:|:|      ..:||.:|               ::...|.||::  
Mouse  2109 KYRAALSRLPQQIHHYLNASDWE------RQVAGAKE---------------KITSFMENYRITD 2152

  Fly  1990 --------GVKINGEPKSDLVNQLGSNKMELEML----YDA-DFKPLNAE-----TDYKPDADEE 2036
                    ..|||...|   ::||.:..::.:..    ||. |.|...||     .:.....||:
Mouse  2153 NDVLIAIDSAKINFNEK---LSQLETYAIQFDQYIKDNYDPHDLKRTIAEIIDRIIEKLKILDEQ 2214

  Fly  2037 YFSYFTNFQVDTLVWPTIVGNVDIQEIIDFYLVVGHVELP-----------------QGKVEFKD 2084
            |     :.:|:.           .:.|.:.||.|.:|:|.                 |.:::.::
Mouse  2215 Y-----HIRVNL-----------AKSIHNLYLFVENVDLNQVSSSNTSWIQNVDSNYQVRIQIQE 2263

  Fly  2085 RLHYPDYINVHNLLTVTTPFAVAKNIKSI-VEYHVD-LNFNAFYERVKFIVNDDKDNTQELGFVF 2147
            :|... ...:.|:........|.:.:.:| |..|:| |.....::|:..|::..|      .||.
Mouse  2264 KLQQL-RTQIQNIDIQQLAAEVKRQMDAIDVTMHLDQLRTAILFQRISDIIDRVK------YFVM 2321

  Fly  2148 NYTALQD-NVKPKAHDVQVTLLTPYEMLHEIYVHGHIE-LDDNAYKGNISAVTAHTHLSMAASIE 2210
            |  .::| .|..|.:..:|.:   .|::.:..|..||: |.|.      |...||.: |::..::
Mouse  2322 N--LIEDFKVTEKINTFRVIV---RELIEKYEVDQHIQVLMDK------SVELAHRY-SLSEPLQ 2374

  Fly  2211 NEDNFLETSVGIQLETDAIPHYGCQVYFKKDFSAVDKAIDIRFEVTDNGTLNQLHIST------- 2268
            ...|.|:.   |:::.          |::|....:|..::....::...|:.:|:..|       
Mouse  2375 KLSNVLQR---IEIKD----------YYEKLVGFIDDTVEWLKALSFKNTIEELNRLTDMLVKKL 2426

  Fly  2269 ---DWHTDPSYIVNANGRIK-----------TTMLPLQMASTSVLVIQGQNPHLNFDLNLLSQNG 2319
               |:|   .::...|.:|:           ...||.:|.:..:||...:....| .|..|....
Mouse  2427 KAFDYH---QFVDKTNSKIREMTQRINAEIQALKLPQKMEALKLLVEDFKTTVSN-SLERLKDTK 2487

  Fly  2320 QSIAYGARAN---KKKD------------VFNIEVWTPMKNFRNI--SMHGTAIRSPRD------ 2361
            .::......:   :.||            ::.:::...:::|.::  .::.|.:....|      
Mouse  2488 VTVVIDWLQDILTQMKDHFQDTLEDVRDRIYQMDIQRELEHFLSLVNQVYSTLVTYMSDWWTLTA 2552

  Fly  2362 ------PGRYDV------------SGFLYRNMATYEVTGAVRMTNSLP-IDVVLRVQPKAGGRDG 2407
                  ..:|.:            .||:...|.|:..|        :| .:|.||...:...:..
Mouse  2553 KNITDFAEQYSIQNWAESIKVLVEQGFIVPEMQTFLWT--------MPAFEVSLRALQEGNFQTP 2609

  Fly  2408 VIELNIHEAGPKKIRFSFSAIEDGKMCQMSGGYSVSKTNGAMDFSVLVESTEPEIARINFYGNLS 2472
            |..:.:.:.....||.:|..:::.|:              .:.||.      ||...:|      
Mouse  2610 VFIVPLTDLRIPSIRINFKMLKNIKI--------------PLRFST------PEFTLLN------ 2648

  Fly  2473 PNSEGSLVGDLSLETPWKALGIDTVHLHS-DVGFLNKGGHIVGEYKIGQYIGRGSCLWSWILAED 2536
                                   |.|:|| .:..|.....|:  ..|.|           ||:.:
Mouse  2649 -----------------------TFHVHSFTIDLLEIKAKII--RTIDQ-----------ILSSE 2677

  Fly  2537 MQLVL-ENYLER----------------------------PNAKPRIVHAS----AKYQNPGQTF 2568
            :|..| |.||..                            ||...:.:|..    .::|.|..:.
Mouse  2678 LQWPLPEMYLRDLDVVNIPLARLTLPDFHVPEITIPEFTIPNVNLKDLHVPDLHIPEFQLPHLSH 2742

  Fly  2569 T-QLQAGGRLS-----------VDSKWNLD----------------VNGSAEYKSVD-DFKFRV- 2603
            | ::.|.|:|.           :|:..|:.                ..|.::::::: ||:.:. 
Mouse  2743 TIEIPAFGKLHSILKIQSPLFILDANANIQNVTTSGNKAEIVASVTAKGESQFEALNFDFQAQAQ 2807

  Fly  2604 -ITALPLP-------------VGDRHQLSASYQGNVI---------------SQQFNNPDFVLEA 2639
             :...|.|             |...|:....:.|..|               ..:|||...|...
Mouse  2808 FLELNPHPPVLKESMNFSSKHVRMEHEGEIVFDGKAIEGKSDTVASLHTEKNEVEFNNGMTVKVN 2872

  Fly  2640 SYESFEAQNKLL-----------SRISYKNATNNLKGLGHV--------EWG-KIQNLS------ 2678
            :..:.::..|..           |:.|..|....|...|||        .|. ...|.|      
Mouse  2873 NQLTLDSHTKYFHKLSVPRLDFSSKASLNNEIKTLLEAGHVALTSSGTGSWNWACPNFSDEGIHS 2937

  Fly  2679 -----VVEGDFELLHKQGAQREFSAK--IITPKFKNEHTFALTGSYDLEKSGHHNVVGSLDYPAS 2736
                 .|:|....:   |.....:.|  .:..|...|..|.....:::|.......|||....|:
Mouse  2938 SQISFTVDGPIAFV---GLSNNINGKHLRVIQKLTYESGFLNYSKFEVESKVESQHVGSSILTAN 2999

  Fly  2737 RRITDLDVSVSSL----SNMHGIFNSTLPTFLNVSWLKTDFNFTTNN-------------GK--- 2781
            .|....|......    :|::|....||...|..|....:...:|||             ||   
Mouse  3000 GRALLKDAKAEMTGEHNANLNGKVIGTLKNSLFFSAQPFEITASTNNEGNLKVGFPLKLTGKIDF 3064

  Fly  2782 --------SYRYCRCFWPQDTAY--FKLNSNYDSDSSNFNHN------LNGNVEIE---VPL--- 2824
                    |.|..:..|...|.:  :|.|.|:  .:.|..||      :||:..::   :||   
Mouse  3065 LNNYALFLSPRAQQASWQASTRFNQYKYNQNF--SAINNEHNIEASIGMNGDANLDFLNIPLTIP 3127

  Fly  2825 ------------------------------ATRHRADIVYGLQKRRNQDAGNVKV--------VY 2851
                                          .|:...|:....|.::|.|..::.|        :.
Mouse  3128 EINLPYTEFKTPLLKDFSIWEETGLKEFLKTTKQSFDLSVKAQYKKNSDKHSIVVPLGMFYEFIL 3192

  Fly  2852 NEKQVLDGKYKRLEQAKAPIYKETTDISLENEVKPLGIHFVSTRDASDPAGSQDVKHIEI--YEL 2914
            |.....|.|:::                    |:...:||::|        |.:...|::  |:.
Mouse  3193 NNVNSWDRKFEK--------------------VRNNALHFLTT--------SYNEAKIKVDKYKT 3229

  Fly  2915 RNTQN-----FNLTGELHSRATLKAQDFKVVAIHPNRAVVLSTKYEDVS---PEVVRHHSKLELS 2971
            .|:.|     |...|.......::...|.|..:..:..:..:.....|:   |.::....||.|.
Mouse  3230 ENSLNQPSGTFQNHGYTIPVVNIEVSPFAVETLASSHVIPTAISTPSVTIPGPNIMVPSYKLVLP 3294

  Fly  2972 ETAWIGYNLELGNFSKVGNESQSFALEIFYPK-RNLSSSGQYYMTDT-NFNSDLSFQ-------W 3027
            .       |||..|...||     ..:.|.|. :..::....|:... ||..|.||:       .
Mouse  3295 P-------LELPVFHGPGN-----LFKFFLPDFKGFNTIDNIYIPAMGNFTYDFSFKSSVITLNT 3347

  Fly  3028 LGGNYDQQPKIIH---------SNLQWKAEPLHRGDREHRTIALTVAHPLLEKDIN--------- 3074
            ..|.|:|...:.|         ..||:|.|...|..|: |.:.|..|..|..|.:.         
Mouse  3348 NAGLYNQSDIVAHFLSSSSFVTDALQYKLEGTSRLMRK-RGLKLATAVSLTNKFVKGSHDSTISL 3411

  Fly  3075 CKATYYRGLRDLLRTHLTIDYSEYPDQL-------------IELG-------------------- 3106
            .|......:|.....|..|....:..:|             |||.                    
Mouse  3412 TKKNMEASVRTTANLHAPIFSMNFKQELNGNTKSKPTVSSSIELNYDFNSSKLHSTATGGIDHKF 3476

  Fly  3107 --AQLTDRYSELGHT------NYTFHVYGKHIASELDVQLN--GTLAAMN--------------- 3146
              ..||..:|....|      ::....|...:|:|.:|.||  ||.:::.               
Mouse  3477 SLESLTSYFSIESFTKGNIKSSFLSQEYSGSVANEANVYLNSKGTRSSVRLQGASKVDGIWNVEV 3541

  Fly  3147 ----------------------------SYY--KTESTAHYKRDIFP--------ARYGKFLALL 3173
                                        ||:  |.:.|.....::.|        ....:..:||
Mouse  3542 GENFAGEATLQRIYTTWEHNMKNHLQVYSYFFTKGKQTCRATLELSPWTMSTLLQVHVSQLSSLL 3606

  Fly  3174 D--------------------------VNKRELEYERQ--SPFHAVRLHL----------LPTIR 3200
            |                          |..|.|::..|  :....:||.|          |..|.
Mouse  3607 DLHHFDQEVILKANTKNQKISWKGGVQVESRVLQHNAQFSNDQEEIRLDLAGSLDGQLWDLEAIF 3671

  Fly  3201 YPIYG---------------LNATIWDTPDTNHSGYI----YMDILERYARMDFNL--------- 3237
            .|:||               |.|:.......|.:||:    ..::.:|:......|         
Mouse  3672 LPVYGKSLQELLQMDGKRQYLQASTSLLYTKNPNGYLLSLPVQELADRFIIPGIKLNDFSGVKIY 3736

  Fly  3238 ----TEDASQNLQMVGYIPDTRSAFLDIWRNY-----EEIRVIDVSSYLKMNHSRLITGRFHWRP 3293
                |...:.||.|   :|..:...:|:...|     ..:.:.:.:.                 |
Mouse  3737 KKLSTSPFALNLTM---LPKVKFPGIDLLTQYSTPEGSSVPIFEATI-----------------P 3781

  Fly  3294 SIRQEVRE----KIQAVGKSVYS----------------------------SFSEGIDFWIKSIY 3326
            .|...|.:    |...||.:|:.                            .||.....:| ..:
Mouse  3782 EIHLTVSQFTLPKSLPVGNTVFDLNKLANMIADVDLPSVTLPEQTIVIPPLEFSVPAGIFI-PFF 3845

  Fly  3327 TETTESMGVV-----------WNTAKEYNRDFIDD--------------IGQLSVLEEDL----- 3361
            .|.|...|:.           |.|..::...|:|.              :.:...:||||     
Mouse  3846 GELTARAGMASPLYNVTWSAGWKTKADHVETFLDSMCTSTLQFLEYALKVVETHKIEEDLLTYNI 3910

  Fly  3362 ------ADLRLFVNQ-------------------SYEANDFYI----------KNVVNFTL-TI- 3389
                  .|..:..|:                   |....||::          .:..:.|: |: 
Mouse  3911 KGTLQHCDFNVEYNEDGLFKGLWDWQGEAHLDITSPALTDFHLYYKEDKTSLSASAASSTIGTVG 3975

  Fly  3390 LD--------ELAIRDHIESLPK----IFSELWQAMGDSGKALRNSIVW-------LIETIKTTY 3435
            ||        ||.:..|.:|.|:    ||...|:.....|:.. ..|.|       |:.::|:..
Mouse  3976 LDSSTDDQSVELNVYFHPQSPPEKKLSIFKTEWRYKESDGERY-IKINWEEEAASRLLGSLKSNV 4039

  Fly  3436 NNLLDAVARFFHGESLVYISGLLEKGI---AKY-DSFIKDLHIKFIK---------YIENLWHKT 3487
            .....|:..:.:...|.|:|..|.|.:   |:: ...:.::::.|.:         |.|.|..|:
Mouse  4040 PKASKAIYDYANKYHLEYVSSELRKSLQVNAEHARRMVDEMNMSFQRVARDTYQNLYEEMLAQKS 4104

  Fly  3488 WTLAENHWKAVL--------KRFEPHLFKMISFIETTAWNLSK-----------EVFDFIYKRT- 3532
            .::.||..|.||        |.....::.|.|||....:|..:           |::..:.|.| 
Mouse  4105 LSIPENLKKRVLDSIVHVTQKYHMAVMWLMDSFIHFLKFNRVQFPGYAGTYTVDELYTIVMKETK 4169

  Fly  3533 ------------------NELAES----------PYFNK-------VSSFTADAERL----YRDF 3558
                              |::.:|          |:|:|       :..|..:...|    .:|.
Mouse  4170 KSLSQLFNGLGNLLSYVQNQVEKSRLINDITFKCPFFSKPCKLKDLILIFREELNILSNIGQQDI 4234

  Fly  3559 KANDAITNIKKYSTIAWNFVKEK------------------YFKL-VPFG------------AEL 3592
            |....:::::.:.....:.::|:                  .||: ||:.            .|.
Mouse  4235 KFTTILSSLQGFLERVLDIIEEQIKCLKDNESTCVADHINMVFKIQVPYAFKSLREDIYFVLGEF 4299

  Fly  3593 NEVLTEIWQE-IKELEKIDQVQIMVQKYYEVMAKVDWVADELQLEHRLHQVYGLVRNKFRN---- 3652
            |:.|..|.|| ..:|:::.|....:::.|...:.|.|.....::|..:.::...:...||:    
Mouse  4300 NDFLQSILQEGSYKLQQVHQYMKALREEYFDPSMVGWTVKYYEIEENMVELIKTLLVSFRDVYSE 4364

  Fly  3653 YAMNALETADMYREAKTKFVFDPEVGIIDLEQKLPM------SWHAFNETPRFEEIPEYQVLAKA 3711
            |::.|.:.|........:||..      |:.:.|.|      .|        .|:|.|..::||.
Mouse  4365 YSVTAADFASKMSTQVEQFVSR------DIREYLSMLTDINGKW--------MEKIAELSIVAKE 4415

  Fly  3712 QSFFSETNSSIVMKLYNMRTH---LDPKTWLPPYYSRAL-----LID--SRHYMTFDQRYV 3762
            ......|..:.:|..|..:.|   .|....|..||.:.:     |||  .::|..| .||:
Mouse  4416 TMKSWVTAVAKIMSDYPQQFHSNLQDFSDQLSSYYEKFVGESTRLIDLSIQNYHVF-LRYI 4475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 129/620 (21%)
DUF1943 665..1012 CDD:286281 81/364 (22%)
DUF1081 1029..1122 CDD:283982 20/97 (21%)
VWD 3741..3908 CDD:295339 9/30 (30%)
C8 3951..4014 CDD:285899
ApobNP_033823.2 Heparin-binding. {ECO:0000250} 32..126 23/126 (18%)
Vitellogenin_N 46..597 CDD:279663 130/623 (21%)
Heparin-binding. {ECO:0000250} 232..306 21/79 (27%)
DUF1943 632..944 CDD:286281 80/363 (22%)
Heparin-binding. {ECO:0000250} 902..959 11/58 (19%)
DUF1081 961..1062 CDD:283982 27/123 (22%)
Heparin-binding. {ECO:0000250} 2042..2177 24/159 (15%)
Heparin-binding. {ECO:0000250} 3155..3230 16/103 (16%)
Basic (possible receptor binding region). {ECO:0000250} 3168..3178 3/10 (30%)
LDL receptor binding. {ECO:0000250} 3368..3388 7/21 (33%)
Heparin-binding. {ECO:0000250} 3378..3511 21/134 (16%)
Basic (possible receptor binding region). {ECO:0000250} 3381..3389 3/9 (33%)
ApoB100_C 4434..4490 CDD:289274 12/44 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 1 Normalized mean entropy S10273
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T616068
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.