DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and vit-1

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:NP_509305.1 Gene:vit-1 WormBaseID:WBGene00006925 Length:1616 Species:Caenorhabditis elegans

Alignment Length:1861 Identity:344/1862 (18%)
Similarity:634/1862 (34%) Gaps:611/1862 (33%)


  Fly   128 NEESESQNYDNMHPKSSDFNVDLTKNLLRFAFHDGLISEVCPQEQETPWVLNIKKGILS--AFQN 190
            :|:..|.|.......|.::. .:.|..||....:|||:|:...:::..|..|:|:.:::  :|..
 Worm    85 SEQIPSLNSMEQRELSEEYK-QMLKLPLRAQLRNGLIAELQFDKEDAEWSKNMKRAVVNMISFNP 148

  Fly   191 TMMRFDV-------------DANTT----ETDVSGQCQVQYALEDTDSSYVTIRK------TKDI 232
            ...|.::             :.||:    |..:.|.|||         :|..||:      ||.|
 Worm   149 IAPRNEIEKIESSYDKEEQSEENTSFFTNEKTLEGDCQV---------AYTVIREQKKTIITKSI 204

  Fly   233 N--SCRQR----YATHSVLQTTPYTFRDDKTIWPILKSQSHCNLTIDNNVYKEIKCLETHLLVPF 291
            |  .|.:|    |.                     |:..|.|.....:.|....:.:.|::|   
 Worm   205 NFDKCTERSEIAYG---------------------LRYSSECPECEKDTVLIRPQTVYTYIL--- 245

  Fly   292 SNASSGALTTSTSRLKLDGVESYSAGEFLEQNPELVERRATLVFDHTPAVKPSHDEIKAARELLV 356
                      ....||...|.|........|.....|.|:.||.:...::|...:::...:|.::
 Worm   246 ----------ENEELKESEVRSLYTVNVNGQEVMKTETRSKLVLEENHSIKSHIEKVNGEKESII 300

  Fly   357 ------EMCRVGFPNIQREFIDVFTNFLQTSKSLDYKTLSVLLQ--------------------R 395
                  ::....|.|..:.....|..|....|....||::..:|                    |
 Worm   301 YSSRWEQLVEDFFKNGDKAEFAPFEKFPLDKKMHLIKTITEQIQEVENNIPETSHFLARLVRIFR 365

  Fly   396 SASTCEQGRNH-------------LLE-SLPFIGSTASYKVMRDQIINEKLTKQMAHDWMTALSF 446
            :.||.:....|             |:| :|...|:..:.:.:...|.||.:....|...:.::..
 Worm   366 TTSTSQLKEIHETLYVKADKKIQSLMEHALAIAGTKNTIQHILVHIENEDIVPLEAAQLLKSIQE 430

  Fly   447 ITRPDEETLETFHSILEYAKNRLDAEYT-------LGATAVVHSFCKHHEACEENLR--VQQIIN 502
            ...|.:...|   :::::|::|:.....       |.|.:||.....:     :|:|  |::...
 Worm   431 TPFPSQTIAE---ALIKFAESRVSKNNQVVRQSAWLAAGSVVRGIVDY-----KNIRPLVREDKR 487

  Fly   503 LLETEFLNLY-NLFKGERRTRERMVILLKGLGNIGVVSSAFAEQLQWIIREDEAPVDIRLHGILA 566
            .|:.:||.:: ..:|....|.|: ::.||.:||.|:..|  ..||..||.:....:.:|...|.|
 Worm   488 ELKEKFLRVFMQQYKDAETTYEK-ILALKSIGNAGLDIS--VNQLNEIIVDKRQLLPVRKEAIDA 549

  Fly   567 FRRVDCARHR---SYFLDNYGNYTLNSELRIYSYLQAM--RCPDYISVGVIKSILEHEEINQVGS 626
            .|.:.....|   ...|..|.|.....|:|:.:..:.|  |..:.:.|.|: |.:|.|...||.:
 Worm   550 LRLLKDTMPRKIQKVLLPIYKNRQYEPEIRMLALWRMMHTRPEESLLVQVV-SQMEKETNQQVAA 613

  Fly   627 FVWSHLTNLAKSNSPVRIEAQGLLLNDELS-ERFKMDIRKFSRNYEHSLFFDEYNF-GTTTDANV 689
            .....:.:.|||.:|. .:...::.:..|| .|::...:..:.:|.....|.:.:| |...|...
 Worm   614 LTHQMIR
HFAKSTNPC-YQRVAIVCSKVLSFTRYQPQEQMIASSYAQLPLFLQNSFSGAQFDFAA 677

  Fly   690 IFGTDSYLPRIASVNFTADLFGQSVN--FFEFTARAEGLEELAANAFGPKGPLSGQLLRKKLSFL 752
            ||..:|:|.:....:..| :||.:.|  |.:.....:.:::..            |:..:||   
 Worm   678 IFEKNSFLLKDLHASLDA-VFGGNWNKYFAQIGFSQQHMDKYV------------QMALEKL--- 726

  Fly   753 NRWLGNESAEEDDTL--------ENLLSLDNLRLKRKAQEQARASEEEVDEDYDFEESLEGNKRQ 809
                  ||.|::.|.        ..:..|..|.||...  :||.:      :|        |::.
 Worm   727 ------ESIEKESTTVVRGRRIQTGITLLKELALKMNI--RARPA------NY--------NEKD 769

  Fly   810 KRDVSTTRKQEIDRNVDSLGYKLKYDYNNPRAQFGLRVFGNDLRYFNVESLVEVMALAAKFNPFQ 874
            ...:...|.:::|..:..:..:|                        :|.|:|......|.. |.
 Worm   770 AFAMVYLRYKDMDYAILPVDTQL------------------------IEKLIEKYISNGKVQ-FS 809

  Fly   875 QAKNVLSGK-EFTYTKSRVFLDASYTVPLAVGLPLAIHAFGASSIDLRVSGNLDEMDPPTDWHFD 938
            :.:.:|:.: ||....:..|.:|....|..:||||.            |||.:     ||  .|.
 Worm   810 EIRRLLNQEHEFETHHAAYFYEAIRKFPTTLGLPLI------------VSGKI-----PT--VFS 855

  Fly   939 VEGQF---------------KPSVSVDVITTMQ--TDMFWEQSGIK-VKS-NLYSNSELVAKLKV 984
            .||||               :|||:...:..|:  |.:|  :.|:| |:| ..|:..::.|.:.:
 Worm   856 AEGQFSLGLEETELRLTVEARPSVAATHVYEMRMFTPLF--EQGVKSVQSVRAYTPIKIQAVVGM 918

  Fly   985 RGRNLVSFSFDLPRDKNEIFSVRSELLV---------------QKREEQLPQAGIANRSANSTCT 1034
            :....:.:...:|.::..|.|:.:..:|               ::|...:||             
 Worm   919 KRNFEIVYKVVVPENQKSIISLTTRPVV
FLRFPGFSKFEYIEAEERTVVVPQ------------- 970

  Fly  1035 WPVLDQAI-------GLQMCSHYSVPDLSNATEIYPSLLLA------------GPLNFSL----- 1075
            |....|.|       ||::.:..::  |:..|  ..:.|||            .|..|:.     
 Worm   971 WQQKTQEIEKVFNFLGLEVSTRGNI--LNQHT--LENWLLAEQDFEVSVENKYRPAEFTARLTVG 1031

  Fly  1076 ILKKSDLSAKKY--VFEYKWDQQEEDNNFSLVFTTPGSKVPRVLVANVTKVPDAFNASVAFVNGP 1138
            .|:|::||..||  :||.:::.::|:......:.|.       :|.::.| ...:.:.|:.    
 Worm  1032 QLEKTELSQIKYNKIFEKEFELEQENTESRREYFTK-------MVKSIQK-EQGYKSVVSL---- 1084

  Fly  1139 NRVSAGCSYDGNPDFRRL-DIYLDTNGNRSLDLGMELRRH---QDFTAWIYNPRMLLAINGVNIT 1199
             |:.|...|..|.:...: |..:     |.....:|:||.   ::...|....::|:        
 Worm  1085 -RLEAPRDYTMNTEVTTVCDKQV-----RMCQWEVEIRRSPILEETKEWTLRSQLLV-------- 1135

  Fly  1200 GLAGTVKVNEKNGIKQ-HD-----VDLSFETKKLQAVIKGNVVQSEITTSTNMTIKYRFQANKIE 1258
                 |:....:.::| ||     |.||..:      ..|:..:||:|.:..:            
 Worm  1136 -----VRPEMPSSLRQLHDQPHREVQLSLTS------TWGSQKKSEVTVNAQL------------ 1177

  Fly  1259 EINFAGKLVNNGDKSKTEYRGNMKLQTSAYPKLNFASESTWLSLQGHTEGMITYNNAPDYVNPNY 1323
                      ...|.:.:|..||                     ..|..||           |.|
 Worm  1178 ----------QQSKEQKKYERNM---------------------DRHFNGM-----------PEY 1200

  Fly  1324 TSLVRLIFARSHSEDSFLDGTQTRASLELKLPRSKIDYRILVKHKEHIK------------NGTE 1376
            ..|::.  ||.:         |..|..|.||.|.  ..::|.::.:.:|            |...
 Worm  1201 ELLIKA--ARLN---------QINAVAEYKLTRE--TEQVLARYFDLVKAYNYWTVSSRPENNEN 1252

  Fly  1377 HNVIVGLKYTPEK------------EITGLFSVHLPRRNLFAIDAYMNV--TVPEFNSCTASLKV 1427
            ..|:|.|...|..            |...|.:|.:||..|.:| |..:|  .:.|.:.....::.
 Worm  1253 DRVVVQLTVEPMSRQYVNITMQSPIERVELKNVQVPRVYLPSI-AQRSVKHLLNEASGSVCKVQK 1316

  Fly  1428 NEKATKDYIIFINGSWFTGHSVAVKANYKDRSSRVQALHHLKMIVESPSFNITSLNIIYRRKQLL 1492
            |:..|.|.::: |....|.:|:..    ||.|             |.|:|.:.|.......::::
 Worm  1317 NQIRTFDDVLY-NTPLTTCYSLIA----KDCS-------------EEPTFAVLSKKTEKNSEEMI 1363

  Fly  1493 IFYDIQAKYDQDPYGLTIQYASNAHNRNTNAEVRLKVKERDYWINAKLLSEQPKLLQLEIHMDKI 1557
            |      |..:....:..|.        .|.|:|:||..:      |:|||.....|:|      
 Worm  1364 I------KVIRGEQEIVAQL--------QNEEIRVKVDGK------KILSEDYSAHQIE------ 1402

  Fly  1558 RDVHIQVGLLNVDKRKELSLELKWDANRDPSQRLGLLAEYNSPGTKHYDGNLMITYPERTIHFGF 1622
                                            |||             :.:::|..||..:.|  
 Worm  1403 --------------------------------RLG-------------ESDIVIELPEGEVRF-- 1420

  Fly  1623 NSFTGGPKYFGKVHASWSINEVIEFEYEAGILPGHTLHNWVKAELRTPFDGWRVNSLDAGIYSLK 1687
                                            .|:|    :|.:|.:              ||.|
 Worm  1421 --------------------------------DGYT----IKTQLPS--------------YSRK 1435

  Fly  1688 NLI--LVNSTLFWADDQKLQVGYKSDYDVNDQLMSFDVRFGINSTIRDIPTINVKVKHWMDVKKV 1750
            |.:  |..:.    ||:.....|.||......:..|...:.:.:  .:......::....:.:|.
 Worm  1436 NQLCGLCGNN----DDESTNEFYTSDNTETKDIEEFHRSYLLKN--EECEAEEERLSEKKNYRKY 1494

  Fly  1751 DTELYLG--YSGQNDTFNTYSMDSSWEIEKNQRYNNYSGLV 1789
            |...|..  ||.: :|:: |..:::.:.:||||....|.||
 Worm  1495 DERKYESEEYSFE-ETYD-YEQENTNKKQKNQRSQKKSDLV 1533

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 116/591 (20%)
DUF1943 665..1012 CDD:286281 72/378 (19%)
DUF1081 1029..1122 CDD:283982 23/119 (19%)
VWD 3741..3908 CDD:295339
C8 3951..4014 CDD:285899
vit-1NP_509305.1 Vitellogenin_N 24..620 CDD:279663 116/591 (20%)
DUF1943 655..946 CDD:286281 72/375 (19%)
VWD 1301..1458 CDD:214566 49/302 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23345
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.