DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and vit-2

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:NP_508868.1 Gene:vit-2 WormBaseID:WBGene00006926 Length:1613 Species:Caenorhabditis elegans

Alignment Length:1950 Identity:362/1950 (19%)
Similarity:650/1950 (33%) Gaps:664/1950 (34%)


  Fly   128 NEESESQNYDNMHPKSSDFNVDLTKNLLRFAFHDGLISEVCPQEQETPWVLNIKKGILS--AFQN 190
            :|:..|.|.......|.::. .:.:..||....:|||||:...:::..|..|:|:.:::  :|..
 Worm    85 SEQMPSLNSMEQRELSEEYK-QMLELPLRAQLRNGLISELQFDKEDAEWSKNMKRAVVNMISFNP 148

  Fly   191 TMMRFDV-------------DANTT----ETDVSGQCQVQYALEDTDSSYVTIRK------TKDI 232
            ...|.::             :.||:    |..:.|.|||         :|..||:      ||.|
 Worm   149 IAPRNEIEKIESSYDKEEQSEENTSFFTNEKTLEGDCQV---------AYTVIREQKKTIITKSI 204

  Fly   233 N--SCRQ--------RYATHSVLQTTPYTFRDDKTIWPILKSQSHCNLTIDNNVYK--EIKCLET 285
            |  .|.:        ||::.     .|...:|.:.|.|    |:.....::|...|  |::.|.|
 Worm   205 NFDKCTERSEIAYGLRYSSE-----CPECEKDTELIRP----QTVYTYVLENEELKESEVRSLYT 260

  Fly   286 HLLVPFSNASSGALTTSTSRLKLDGVESYSAGEFLEQNPELVERRATLVFDHTPAVKPSHDEIKA 350
                                :.::|.|...           .|.|:.||.:...::|....::..
 Worm   261 --------------------VNVNGQEVMK-----------TETRSKLVLEENHSIKSHIKKVNG 294

  Fly   351 ARELLV------EMCRVGFPNIQREFIDVFTNFLQTSKSLDYKTLSVLLQRSASTCEQGRNHLLE 409
            .:|.::      ::....|.|..:.....|..|....|....||::..:|...:...: .:|.|.
 Worm   295 EKESIIYSSRWEQLVEDFFKNGDKAEFAPFEKFPLDKKMHLIKTITEQIQEVENNMPE-TSHFLA 358

  Fly   410 SLPFIGSTASYKVMRDQIINEKL--------------------TK--------QMAHDWMTALSF 446
            .|..|..|.|...:::  |:|.|                    ||        .|.::.:..|..
 Worm   359 RLVRIFRTTSTSQLKE--IHETLYVKADKKIQSLMEHALAIAGTKNTIQHILVHMENEDILPLGQ 421

  Fly   447 ITRPDEETLETFHSILE---------YAKNRLDAEYT--LGATAVVHSFCKHHEACEENLR--VQ 498
            |.:..:||.....||.|         .|||.|.....  |.|.:||.....:     :|:|  |:
 Worm   422 ILKTIQETPFPSQSIAEALIKFAESRVAKNNLVVRQAAWLAAGSVVRGIVDY-----KNIRPLVR 481

  Fly   499 QIINLLETEFLNLY-NLFKGERRTRERMVILLKGLGNIGVVSSAFAEQLQWIIREDEAPVDIRLH 562
            :....|:.:||.:: ..:|....|.|: ::.||.:||.|:..|  ..||..||.:...|:.:|..
 Worm   482 EDKRELKEKFLRVFMQQYKDAETTYEK-ILALKTIGNAGLDIS--VNQLNEIIVDKRQPLPVRKE 543

  Fly   563 GILAFRRVDCARHR---SYFLDNYGNYTLNSELRIYSYLQAM--RCPDYISVGVIKSILEHEEIN 622
            .|.|.|.:.....|   ...|..|.|.....|:|:.:..:.|  |..:.:.|.|: |.:|.|...
 Worm   544 AIDALRLLKDTMPRKIQKVLLPIYKNRQYEPEIRMLALWRMMHTRPEESLLVQVV-SQMEKETNQ 607

  Fly   623 QVGSFVWSHLTNLAKSNSPVRIEAQGLLLNDELS-ERFKMDIRKFSRNYEHSLFFDEYNF-GTTT 685
            ||.:.....:.:.|.|.:|. .:...::.:..|| .|::...:..:.:|.....|.:.:| |...
 Worm   608 QVAALTHQMIR
HFAMSTNPC-YQRVAIVCSKVLSFTRYQPQEQMIASSYAQLPLFLQNSFSGAQF 671

  Fly   686 DANVIFGTDSYLPRIASVNFTADLFGQSVN--FFEFTARAEGLEELAANAFGPKGPLSGQLLRKK 748
            |...||..:|:||:....:..| :||.:.|  |.:.....:.:::..            |:..:|
 Worm   672 DFAAIFEKNSFLPKDLHASLDA-VFGGNWNKYFAQIGFSQQHMDKYV------------QMALEK 723

  Fly   749 LSFLNRWLGNESAEEDDT--------------LENLLSLDNLRLKRKAQEQARASEEEV------ 793
            |         ||.|::.|              |:.|....|:|.:     .|..:|::.      
 Worm   724 L---------ESLEKESTTVVRGRRIQTGIKLLKELAQKMNIRAR-----PATYTEKDAFAMVYL 774

  Fly   794 ---DEDYDFEESLEGNKRQKRDVSTTRKQEIDRNVDSLGYKLKYDYNNPRAQFGLRVFGNDLRYF 855
               |.||.|                   ..|||.:                              
 Worm   775 RYKDMDYAF-------------------LPIDRQL------------------------------ 790

  Fly   856 NVESLVEVMALAAKFNPFQQAKNVLSGK-EFTYTKSRVFLDASYTVPLAVGLPLAIHAFGASSID 919
             ||:|:|......|.. |.:.:.:|:.: ||....:..|.:|....|..:||||.|         
 Worm   791 -VENLIEKFTSNGKVQ-FSEIRRLLNQELEFETHHAAYFYEAIRKFPTTLGLPLTI--------- 844

  Fly   920 LRVSGNLDEMDPPTDWHFDVEGQF---------------KPSVSVDVITTMQ--TDMFWEQSGIK 967
               ||.:     ||  ....||||               :|||:...:..|:  |.:|  :.|:|
 Worm   845 ---SGKI-----PT--VISAEGQFSLELEGTELRLTVEARPSVAATHVYEMRMFTPLF--EQGVK 897

  Fly   968 ----VKSNLYSNSELVAKLKVRGRNL-VSFSFDLPRDKNEIFSVRSELLV--------------- 1012
                |::......:.||.:|   ||. :.:...:|.::..|.|:.:..:|               
 Worm   898 SVQSVRAYTPIKIQAVAGMK---RNFEIVYKVVVPENQKSIVSLTTRPVVFLRFPGFSKFEYIEA 959

  Fly  1013 QKREEQLPQ--------------AGIANRSANSTCTWPVLDQAIGLQMCSHYSVPDLSNATEIYP 1063
            ::|...:||              .|:...:..:......|:..:..:.....||.:.:...| :.
 Worm   960 EERTVVVPQWQQKTQEIEKVFNFLGLEVSTRGNILNQHTLENWLLAEQDFEVSVENKNRPAE-FT 1023

  Fly  1064 SLLLAGPLNFSLILKKSDLSAKKY--VFEYKWDQQEEDNNFSLVFTTPGSKVPRVLVANVTKVPD 1126
            :.|..|.      |:|::||..||  :||.:::.::|:       |....:....:|.|:.| ..
 Worm  1024 ARLTVGQ------LEKTELSQIKYNKIFEKEFELEQEN-------TESRREYFNKMVKNIQK-EQ 1074

  Fly  1127 AFNASVAFVNGPNRVSAGCSYDGNPDFRRLDIYLDTNGNRSLDLGMELRRH---QDFTAWIYNPR 1188
            .:.:.::.     ::.|...|..|.:   |....|.. .|.....:|:||.   ::...|....:
 Worm  1075 GYKSVISL-----KLEAPRDYTMNTE---LTTVCDKQ-VRMCQWEVEIRRSPILEETKEWTLRSQ 1130

  Fly  1189 MLLAINGVNITGLAGTVKVNEKNGIKQ------HDVDLSFETKKLQAVIKGNVVQSEITTSTNMT 1247
            :|:             |:....:.::|      .:|.||..:      ..|:..:||:|.:..: 
 Worm  1131 LLV-------------VRPEMPSSLRQLRDQPHREVQLSLTS------TWGSQKKSEVTVNAQL- 1175

  Fly  1248 IKYRFQANKIEEINFAGKLVNNGDKSKTEYRGNMKLQTSAYPKLNFASESTWLSLQGHTEGMITY 1312
                                 ...|.:.:|..||..|.:                     ||   
 Worm  1176 ---------------------QQSKEQKKYERNMDRQFN---------------------GM--- 1195

  Fly  1313 NNAPDYVNPNYTSLVRLIFARSHSEDSFLDGTQTRASLELKLPRSKIDYRILVKHKEHIK----- 1372
                    |.|..|::.  ||.:         |..|..|.||.|.  ..::|.::.:.:|     
 Worm  1196 --------PEYELLIKA--ARLN---------QINAVAEYKLTRE--TEQVLARYFDLVKTYNYW 1239

  Fly  1373 -------NGTEHNVIVGLKYTP------------EKEITGLFSVHLPRRNLFAIDAYMNV--TVP 1416
                   |.....|:|.|...|            ..|...|.:|.:||..|.:| |..:|  .:.
 Worm  1240 TVSSRPENNENDRVVVQLTVEPMSRQYVNITMQSPMERIELKNVQVPRVYLPSI-AQRSVKHQLT 1303

  Fly  1417 EFNSCTASLKVNEKATKDYIIFINGSWFTGHSVAVKANYKDRSSRVQALHHLKMIVESPSFNITS 1481
            |.:.....::.|:..|.|.::: |....|.:|:..    ||.|             |.|:|.:.|
 Worm  1304 EASGSVCKVQKNQIRTFDDVLY-NTPLTTCYSLIA----KDCS-------------EEPTFAVLS 1350

  Fly  1482 LNIIYRRKQLLIFYDIQAKYDQDPYGLTIQYASNAHNRNTNAEVRLKVKERDYWINAKLLSEQPK 1546
            .......::::|      |..:....:..|.        .|.|:|:||..:      |:.||...
 Worm  1351 KKTEKNSEEMII------KVIRGEQEIVAQL--------QNEEIRVKVDGK------KIQSEDYS 1395

  Fly  1547 LLQLEIHMDKIRDVHIQVGLLNVDKRKELSLELKWDANRDPSQRLGLLAEYNSPGTKHYDGNLMI 1611
            ..|:|                                      |||             :..::|
 Worm  1396 AYQIE--------------------------------------RLG-------------ESAIVI 1409

  Fly  1612 TYPERTIHFGFNSFTGGPKYFGKVHASWSINEVIEFEYEAGILPGHTLHNWVKAELRTPFDGWRV 1676
            ..||..:.|                                  .|:|    :|.:|.:       
 Worm  1410 ELPEGEVRF----------------------------------DGYT----IKTQLPS------- 1429

  Fly  1677 NSLDAGIYSLKNLI--LVNSTLFWADDQKLQVGYKSDYDVNDQLMSFDVRFGINSTIRDIPTINV 1739
                   ||.||.:  |..:.    ||:.....|.||....:.:..|...:.:.:...:.....:
 Worm  1430 -------YSRKNQLCGLCGNN----DDESTNEFYTSDNTETEDIEEFHRSYLLKNEECEAEEERL 1483

  Fly  1740 KVKHWMDVKKVDTELYLGYSGQNDTFNTYSMDSSWEIEKNQRYNNYSGLVH-------------L 1791
            ..|......:.|.|....||.: :|:: |..:::.:.:||||....|.||.             .
 Worm  1484 SEKKNYRKYERDEEQSDEYSSE-ETYD-YEQENTKKSQKNQRSQKKSDLVEKTQIKEFSHRICFS 1546

  Fly  1792 VSPF----KGYEKGGLVAHFSLSDQRVV---------SGAASLNFDLREFTLTMNGYVKKFTDNM 1843
            |.|.    :|||       .....||.:         ..|:.|..:.|:..|.::.|...|.:::
 Worm  1547 VEPVAECRRGYE-------VEQQQQRKIRFTCLQRHNRDASRLLKESRQQPLQLDDYPVSFVESV 1604

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 125/595 (21%)
DUF1943 665..1012 CDD:286281 77/396 (19%)
DUF1081 1029..1122 CDD:283982 18/95 (19%)
VWD 3741..3908 CDD:295339
C8 3951..4014 CDD:285899
vit-2NP_508868.1 Vitellogenin_N 24..618 CDD:279663 125/595 (21%)
DUF1943 653..944 CDD:286281 77/393 (20%)
VWD 1299..1456 CDD:214566 48/302 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23345
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.