DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and vit-5

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:NP_508589.1 Gene:vit-5 WormBaseID:WBGene00006929 Length:1603 Species:Caenorhabditis elegans

Alignment Length:1756 Identity:341/1757 (19%)
Similarity:614/1757 (35%) Gaps:537/1757 (31%)


  Fly    52 YKYQYTVAVRTEFAGSGDNSSDLLLKSDLEIFFPKPCEGYLRINDAKLYDTLDELNDNESDSSE- 115
            |.|::...:.:....:..::|..|:.          |...|:..|.: |..| :|.|.:..:|. 
 Worm    30 YVYKFDGLLLSGLPTASSDASQTLIS----------CRTRLQAVDDR-YIHL-QLTDIQYSASHI 82

  Fly   116 -KTKEYDYYDNLANEESESQNYDNMHPKSSDFNVDLTKNLLRFAF----HDGLISEVCPQEQETP 175
             :::::...::|...|           .|.:|     |.||...|    .:|||||:....::..
 Worm    83 PQSEQWPKIESLEQRE-----------LSDEF-----KELLELPFRAQIRNGLISEIQFSSEDAE 131

  Fly   176 WVLNIKKGILSAF-------------QNTMMRFDVDA---NTTETDVSGQCQVQYAL--EDTDSS 222
            |..|.|:.||:.|             ....|..|.|:   |..|..:.|.|:|.|.:  |...:.
 Worm   132 WSKNAKRSILNLFSLRKSAPVDEMNQDQKDMESDKDSLFFNVHEKTMEGDCEVAYTIVQEGEKTI 196

  Fly   223 YVTIRKTKDIN--SCRQRYATHSVL------------------QTT-PYTFRDDKTIWPILKSQS 266
            |     ||.:|  .|..|..|...|                  ||. .|||:::|    :.:|:.
 Worm   197 Y-----TKSVNFDKCITRPETAYGLRFGSECKECEKEGQFVKPQTVYTYTFKNEK----LQESEV 252

  Fly   267 HCNLTIDNNVYKEIKCLETHLLVPFSNAS---------SG---ALTTSTSRLKLDGVES-YSAGE 318
            |...|::.|..:.:|. ||...|.|...|         ||   .:..|....||  :|. |..|:
 Worm   253 HSVYTLNVNGQEVVKS-ETRAKVTFVEESKINREIKKVSGPKEEIVYSMENEKL--IEQFYQQGD 314

  Fly   319 FLEQNP----ELVERRATL--VF-------DHTPAVKPSHDEIKAARELLVEMCRVGFPNIQREF 370
            ..|.||    |:.::...|  :|       .:||  :..|...:|.|  :..||.:  ..:::..
 Worm   315 KAEVNPFKAIEMEQKVEQLQEIFRQIQEHEQNTP--ETVHLIARAVR--MFRMCTI--EELKKVH 373

  Fly   371 IDVFTNFLQTSKSLDYKTLSVLLQRSASTCEQGRNHLLESLPFIGSTASYKVMRDQIINEKLTKQ 435
            ..::|...:..:.:...||:|     |.| :....||:....                .:.:|..
 Worm   374 TTIYTKAEKKVQLVIETTLAV-----AGT-KNTIQHLIHHFE----------------KKSITPL 416

  Fly   436 MAHDWMTALSFITRPDEETLETFHSILEYAKNRLDAEYT-------LGATAVVHSFCKHHEACEE 493
            .|.:.:.::.....|.|...:.   :::.|::.|..:|.       |.|.:||..|..       
 Worm   417 RAAELLKSVQETLYPSEHIADL---LIQLAQSPLSEKYEPLRQSAWLAAGSVVRGFAS------- 471

  Fly   494 NLRVQQIINLLETEFLNLYNLFKGERRTRER-----------------MVILLKGLGNIGVVSSA 541
                       :|:.|.|  :....|:|:|:                 .|:.||.|||.|:..|.
 Worm   472 -----------KTQDLPL--IRPASRQTKEKYVRVFMQHFRNADSTYEKVLALKTLGNAGIDLSV 523

  Fly   542 FAEQLQWIIREDEAPVDIRLHGILAFRRVDCARHR---SYFLDNYGNYTLNSELRIYSYLQAMR- 602
            :  :|..||::...|:.||...:.|.|.:.....|   ...|..|.|.....|||:.:..:.|. 
 Worm   524 Y--ELVQIIQDPRQPLSIRTEAVDALRLLKDVMPRKIQKVLLPVYKNRQNKPELRMAALWRMMHT 586

  Fly   603 CPDYISVGVIKSILEHEEINQVGSFVWSHLTNLAKSNSP----VRIEAQGLLLNDELSERFKMDI 663
            .|:...:..|.|.:|:|....|.:|.::.|....||.:|    :.:....:|    |..|::...
 Worm   587 IPEEPVLAHIVSQMENESNQHVAAFTYNVLRQFYKSTNPCYQQLAVRCSKIL----LFTRYQPQE 647

  Fly   664 RKFSRNYEHSLFFDEYNFGTTTDANVIFGTDSYLPRIASVNFTADLFGQSVN--FFEFTARAEGL 726
            :..|...:..||..|:..|...|...||..:::||:....:|.. :||.:.|  |.:.....:..
 Worm   648 QMLSTYSQLPLFNSEWLSGVQFDFATIFEKNAFLPKEVQASFET-VFGGNWNKYFAQVGFSQQNF 711

  Fly   727 EELAANAFGPKGPLSGQLLRKKLSFLNRWLGNESAEEDDTLENLLSLDNLRLKRKAQEQARASEE 791
            |               |::.|.|..|:.: |.:|             |.|| .|:.|...:..:|
 Worm   712 E---------------QVILKTLEKLSLY-GKQS-------------DELR-SRRVQSGIQMLQE 746

  Fly   792 EVDEDYDFEESLEGNKRQKRDVSTTRKQEIDRNVDSLGYKLKY---DYNNPRAQFGLRVFGNDLR 853
            .|               :|.::....:|...:|..::.| |:|   ||         .|...|:.
 Worm   747 IV---------------KKMNIRPRVQQTDSQNAHAVFY-LRYKEMDY---------IVLPIDME 786

  Fly   854 YFNVESLVEVMALAAKFNPFQQAKNVLSGKEFTYTKSRVFLDASYTVPLAVGLPLAIHA------ 912
              .:::|||......:|:.......:.:..:|...::..|.:|...:|..:|:||.|..      
 Worm   787 --TIDTLVEKYVRNGEFDIKSLLTFLTNDSKFELHRALFFYEAERRIPTTIGMPLTISGKMPTIL 849

  Fly   913 --FGASSIDLRVSGNLDEMDPPTDWHFDVEGQFKPSVSVDVITTMQTDMFWE---QSGIK--VKS 970
              .|..||:|...|....:|            ..|:|:...:|.|:   ||.   :.|:|  ..:
 Worm   850 SINGKVSIELEKLGARLVLD------------IVPTVATTHVTEMR---FWYPVIEQGVKSLQSA 899

  Fly   971 NLYSNSELVAKLKVRGRNL-VSFSFDLPRDKNEIFSVRS-------------------------- 1008
            .|::.....:.::::...| ::..|.:|.:|....||.:                          
 Worm   900 RLHTPLRFESTVELKKNTLEITHKFVVPENKKTTVSVHTRPVAFIRVPKNQDSEYVEAEEKTISH 964

  Fly  1009 ---ELLVQKREEQLPQAGI-ANRSANSTCTWPVLDQAIGLQMCSHYSVPDLSNATEIYPSLLLAG 1069
               ::..::.:.|....|: .|...|....| .|...:..:....|::.:.:...|....:.:..
 Worm   965 SQYQMSTEEIDRQYETFGLRINAQGNVLSQW-TLPMVLMTEQDFEYTLENKNRPVEFTARVTIGN 1028

  Fly  1070 PLNFSLILKKSDLSAKKY--VFEYKWD-QQEEDNNFSLVFTTPGSKVPRVLVANVTKVPDAFNAS 1131
                   |:|:|||..|:  :||.::| :..|..|....|        ..::..:.......|..
 Worm  1029 -------LEKTDLSEIKFDKIFEKEFDLENNESENRRQYF--------HKMIREIQSEQGFKNLI 1078

  Fly  1132 VAFVNGPNRVSAGCSYDGNPDFRRL-DIYLDTNGNRSLDLGMELRR----HQDFTAWIYNPRMLL 1191
            ...:..|.::.      .|.:.|.: |.::     |...:.|:.||    |:: ..|.....:|.
 Worm  1079 TLKLEAPQQMY------WNTELRTVCDKWI-----RMCKVEMDARRSPMEHEN-KEWTLRTELLA 1131

  Fly  1192 AINGVNITGLAGTVKVNEKNGIKQ------HDVDLSFETKKLQAVIKGNVVQSEITTSTNMTIKY 1250
            |             :....:.::|      .:|.|:|..|      .|:..:||||.:.      
 Worm  1132 A-------------RPQMPSSLRQLREQPHREVQLAFNAK------WGSSKKSEITVNA------ 1171

  Fly  1251 RFQANKIEEINFAGKLVNNGDKSKTEYRG----NMKLQTSAYPKLNFASESTWLSLQGHTEGMIT 1311
                 ::|:.....|.:.|.::   ||:|    .:.::.:...::|..||               
 Worm  1172 -----QLEQSTEQKKFIRNIER---EYKGIPEYELLIKAARLNQVNVVSE--------------- 1213

  Fly  1312 YNNAP--DYVNPNYTSLVRLIFARSHSEDSFLDGTQTRASLELKL-PRSKIDYRILVKHKEHIKN 1373
            |...|  :|.......|::.....:.||.. :.....|..|:|.: |.|:....:.::       
 Worm  1214 YKLTPQSEYTFSRIFDLIKAYNFWTVSEKR-VQNENRRVVLQLSVEPLSRQYMNMTIQ------- 1270

  Fly  1374 GTEHNVIVGLKYTPEKEITGLFSVHLPRRNLFAIDAYMNVTVPEFNSCTASLKVNEKATKDYIIF 1438
                        |||:|:. |.:|.:||           |.:|.........:..||        
 Worm  1271 ------------TPEQEVE-LKNVRIPR-----------VVLPTIARSAMFQQTWEK-------- 1303

  Fly  1439 INGSWFTGHSVAVKANYKDRSSRVQALHHLKMIVESPSFNITSLNIIYRRKQLLIFYDIQAK-YD 1502
                  ||.:..|     |:|             |..:|:    |:|| |..|...|.:.|| ..
 Worm  1304 ------TGATCKV-----DQS-------------EVSTFD----NVIY-RAPLTTCYSLVAKDCS 1339

  Fly  1503 QDPYGLTIQYASNAHNRNTNA-EVRLKVKERDYWINAKLLSEQPKLLQLEIHMDKIRDVHIQVGL 1566
            :.|     ::|..|...|.|: |:.:||..|:.                ||.:.|..|..    |
 Worm  1340 EQP-----RFAVLAKKINKNSEELLVKVVRREE----------------EIVVKKSDDKF----L 1379

  Fly  1567 LNVDKRKELSLELKWDANRDPSQRLGLLAEYNSP--GTKHYDGNLMITYPERTIHF-GFNSFTGG 1628
            :.||.:|....||:               :||..  |    |..::|..|:..:.| |:...|..
 Worm  1380 VKVDGKKVNPTELE---------------QYNIEILG----DNLIVIRLPQGEVRFDGYTVKTNM 1425

  Fly  1629 P 1629
            |
 Worm  1426 P 1426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 144/680 (21%)
DUF1943 665..1012 CDD:286281 72/395 (18%)
DUF1081 1029..1122 CDD:283982 17/96 (18%)
VWD 3741..3908 CDD:295339
C8 3951..4014 CDD:285899
vit-5NP_508589.1 Vitellogenin_N 24..617 CDD:279663 144/680 (21%)
DUF1943 651..942 CDD:286281 72/364 (20%)
VWD 1300..1454 CDD:214566 46/209 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23345
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.