DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and vit-6

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:NP_001023276.1 Gene:vit-6 WormBaseID:WBGene00006930 Length:1651 Species:Caenorhabditis elegans

Alignment Length:1859 Identity:339/1860 (18%)
Similarity:616/1860 (33%) Gaps:614/1860 (33%)


  Fly    10 IWLLLL---IAHTQAVRENPLKDPRICGRPQCDSKSAKFNYGEQLYKYQYTVAVRTEFAGSGDNS 71
            |.|.||   :|.|...|.|.:         :.:.:.:.|..|.: |:|.:          :|..|
 Worm     5 IALALLGAALASTHLDRYNSI---------ERNIQESSFRAGRE-YRYLF----------NGQLS 49

  Fly    72 SDLLLKSDLEIFFPKPCEGYLRIND-------------AKLYDTLDELNDNESDSSEKTKEYDYY 123
            :.|.:        |...:|..|:..             .:|..|....:..||:|. |...::.:
 Worm    50 AGLPV--------PSTPQGISRLQSQVTLQWTDGNTVRMQLQKTRFATSQQESNSM-KMLPFERF 105

  Fly   124 DNLANEESESQNYDNMHPKSSDFNVDLTKNLLRFAFHDGLISEVCPQEQETPWVLNIKKGILSAF 188
                 ||.|..|.::.         :|....:.|.:..||:.|:...|.:.||..|||:.:::..
 Worm   106 -----EEVERMNREHQ---------ELLSMPVEFDYEHGLVREIRFAENDQPWSENIKRAVINML 156

  Fly   189 QNTMMRFDVDANTTETD--------------VSGQCQVQYALEDTDSSYVTIRK------TKDIN 233
            |..:::.:......::|              :.|:|:|.|.:|:       |:|      .|.||
 Worm   157 QVNILKKEKYEGAEKSDNQEPTFSFTNVERTLEGECEVLYTVEE-------IKKEDEQRWAKSIN 214

  Fly   234 --SCRQRYATHSVLQTTP------YTFRDDKTIWPILKSQSHCNLTIDNNVY--KEIKCLETHLL 288
              .|.:|...|.|  .||      .|...||....:|    :.|:|..::.:  ..::....||.
 Worm   215 FDKCTRRPYIHHV--QTPVCKDCQQTLEQDKMSSTVL----NYNITGTSSSFLINSVELRSQHLF 273

  Fly   289 VPFSNASS--GALTTSTSRLKLDGVESYSAGEFLEQNPELV----ERRATLVFDHTPAVKPSHDE 347
            .|.|....  .|.|.:|..|...|          |:..|:.    |:.:.||:         :.|
 Worm   274 APISEKHQLVSAFTLNTMELIYAG----------EKKTEIKQVRNEKTSELVY---------NQE 319

  Fly   348 IKAARELLVEMCRVGFPNIQREFIDVFTNFLQTSKSLDYKTLSVLLQRSASTCEQGRNHLLESLP 412
            .:.|.:   :..:.|    :.:::.....:.:....:..|..|::    |...|||... ||:..
 Worm   320 SEWAEQ---QWAQTG----EEKYLRQLPQWTENKVEMIKKMFSLM----AKQIEQGEAE-LEAAH 372

  Fly   413 FIGSTASYKVMR-------DQII-------NEKLTKQMAHDWMTALSFI-TRPDEETLETFHSIL 462
            .:....  ||:|       :||.       :||:.:|:...:...|:.. ||   .|::.|...:
 Worm   373 TVARIV--KVLRECNEEQLEQIYRHVAEHKDEKIAEQLRSIYFNTLALAGTR---VTIQQFVDKV 432

  Fly   463 EYAKN------------RLDAEY------------------------------TLGATAVVHSFC 485
            :..||            .:|..|                              |.|  |:|:..|
 Worm   433 QSRKNIAPLKASVAIKTLVDMRYPSLAIAEDIARLCESDVSSSFPALRQSCWLTYG--AIVNGVC 495

  Fly   486 KHH----------EACEENLRVQQIINLLETEFLNLYNLFKGERRTRERMVILLKGLGNIGVVSS 540
            ...          :.|..:.: |:|::.|..:|        ....||...|:.||.|.|.|:..|
 Worm   496 GQTPRVFVQKNGVKMCPRDAK-QRIVDKLVQQF--------ESASTRYEKVLALKTLANAGLDLS 551

  Fly   541 AFAEQLQWIIREDEAPVDIRLHGILAFRRVDC---ARHRSYFLDNYGNYTLNSELRIYSYLQAMR 602
            .:  .|:.||..::....||...|.:|||:..   .:.:...:..|.|......:|:.:..|.:.
 Worm   552 VY--PLEKIILNEQHETTIRTQAIESFRRLRTQMPTKIQRVLMPVYLNRQQPQHIRMSALHQIIY 614

  Fly   603 C-PDYISVGVIKSILEHEEINQVGSFVWSHLTNLAKSNSPVR----IEAQGLLLNDELS----ER 658
            . |::..:..|.:.|..|...||.:|..|.|.:.|.:.||..    ...|.||.|...|    :|
 Worm   615 TQPEWSVLSQIGNQLRQERNQQVRAFTLSLLRSYANNESPCEQTFSSRVQSLLNNIPFSSQEIDR 679

  Fly   659 FKMDIRK---FSRNYEHSLFFDEYNFGTTTDANVIFGTDSYLPRIASVNFTADLFGQSVNFFE-- 718
            |:....|   :||.::...   |.||.:      :|.|:|.||.....:....|.|:...:|.  
 Worm   680 FESVYGKWSTYSRRHQSGF---EANFAS------LFTTESVLPTEMMASIEGVLSGEWNQYFAQI 735

  Fly   719 -FT--------------ARAEGLEELAANAFGPKGPLSGQLLRKKLSFLNRWLGNESAEEDDTLE 768
             ||              .:.:|||::........|                     |.:..:.|.
 Worm   736 GFTQKNMEKIIKKLLSNVQEKGLEQIVVRGKRASG---------------------SFQPTEFLS 779

  Fly   769 NLLSLDNLRLKRKAQEQARASEEEV---------DEDYDFEESLEGNKRQKRDVSTTRKQEIDRN 824
            ||  |:.||:.|:     ::||::.         |.||.|                     :..:
 Worm   780 NL--LEKLRITRR-----QSSEQDPHAFVYIRHRDMDYAF---------------------LPID 816

  Fly   825 VDSLGYKLKYDYNNPRAQFGLRVFGNDLRYFNVESLVEVMALAAKFNPFQQAKNVLSGKEFTYTK 889
            .||:...::......|.:.|              .:..|:|....|:        .|...|.|..
 Worm   817 ADSIPEVVRSMIQGGRLEIG--------------DIERVLAQGIHFS--------ASNAAFLYET 859

  Fly   890 SRVFLDASYTVPLAVGLPLAIHAFGASSIDLRVSGNLD-EMDPPTDWHFD---VEGQFKPSVSVD 950
            .|       .||..:|||:...:...:...:|  |.:. |::|.....||   :..|..|.|:..
 Worm   860 VR-------RVPTPMGLPVQFTSKMPTISSIR--GQVTFELEPKNGKSFDGLRLRVQAGPRVAST 915

  Fly   951 VITTMQTDMFWEQSGIKVKSNLYSNSELVAKLKVRGRN--LVSFSFDLPRDKNEIFSVRSELLVQ 1013
            .:.:::......:.|.|.......|:.:..::::...:  ::...::.|.::..|..::|..:..
 Worm   916 HVLSLRVICPIAEVGTKFLHQAVLNTPVDTEIRMNWEDKVVIRAIYNTPSEEKRIAMIQSRPVTF 980

  Fly  1014 KR-----EEQLPQAGIANRSANSTCTWPVLDQAIGLQMCSHYSVP---DLSNATE-IYPSLLLAG 1069
            .|     ..|.|:.                     ::|.  |.:|   .||.:.: .||.:.:.|
 Worm   981 TRTVAPDARQYPEP---------------------IEMT--YMLPAHKQLSQSLDREYPQIRVQG 1022

  Fly  1070 PLNFSLILKKSDLSAKKYVFEYKWDQQEEDNNFSLVFTTPGSKVPRVLVANVTKVPDAFNASVAF 1134
            .||     :.:.:...:::.         |:|.. |:..|          ||.:....|.     
 Worm  1023 TLN-----RPTSVRIPQWIV---------DSNVE-VYYKP----------NVEQYEAIFE----- 1057

  Fly  1135 VNGPNRVSAGCSYDGNPDFRRLDIYLDTNGNRSLDLGMEL--RRHQDFTA----WIYNPRMLLAI 1193
            :|..|......:|:        .:|...||.|.|:...|.  ..|::...    |:.|.:     
 Worm  1058 LNLYNNYKMEKNYE--------KVYKKHNGRRYLEAEPEYDEEEHREQITKKFEWLQNEK----- 1109

  Fly  1194 NGVNITGLAGTVKVNEKNGIKQHDVDLSFETKKLQAVIKGNVVQSEITTSTNMTIKYRFQANKIE 1258
                               :.||..  .||       ||..||:.|:....|            .
 Worm  1110 -------------------VYQHVA--KFE-------IKPEVVKMEVEAVCN------------N 1134

  Fly  1259 EINFAGKLVNNGDKSKTEYRGNMKLQTS---AYPKLNFASESTWLSLQGHTE----GMITYNNAP 1316
            :.:|.          ||:.||. :|:.:   .||:.....|.  |..|.:.:    |.:.|....
 Worm  1135 DFHFC----------KTQIRGE-ELKATIQYVYPQTPRTVEE--LKEQKYRQLVVMGEMNYGENT 1186

  Fly  1317 DYVNPNYTSLVRLIFARSHSEDSFLDGTQTRASLELKLPRSKIDYRILVKHKEHIKNGTEHNVIV 1381
            .::|.|        ..:|..:..|:...:.....|..|..|::|               ::..:|
 Worm  1187 IHININ--------GQQSQEQKKFVKQIEQAPEHETLLEASRLD---------------QYQTVV 1228

  Fly  1382 GLKYTPEKEITGLFSVHLPRRNLFA-----IDAYMNVTVPEFNSCTASLKVNEKATKDYII---- 1437
            ..::.|:.            ...||     :.||:....|    .|:.::..|:.::..:|    
 Worm  1229 EYEFEPKP------------AQYFARYWNMVQAYLRTQYP----WTSRIETREEPSRKNMIRATI 1277

  Fly  1438 --------FINGSWFTGHSVAV-------------KANYKDRSSRVQ-------ALHH----LKM 1470
                    .:|.:..|.....|             :.:|:.|:||.:       ..||    ...
 Worm  1278 NVEPRQRLTVNMTIETPMETTVLERVELPFRLPTAQIHYQPRNSRYEQKPVMEKIAHHASKQANC 1342

  Fly  1471 IVESPSFNITSLNIIYRRKQLLIFYDIQAK----YDQDPYGLTIQYASNAHNRNTNAEV------ 1525
            :|:|...| |...:.| |.|....|.:.||    ...:|..:.:....|......|.:|      
 Worm  1343 VVKSTKIN-TFDQVAY-RNQFTPCYSVLAKDCGSEKSEPRFVVLMKKINEKKEWKNVKVVYGENE 1405

  Fly  1526 ------------RLKVKERDYWINAKLLSEQPKLLQLEIHMDKIRDVHIQVGLLNVDKRKELSLE 1578
                        |:..:|.:|...:::..:|..::.|..:..|.....:.|....|:.|..||..
 Worm  1406 IEMYKTEEGLICRVNGEEIEYQPESEIEKKQYNIIWLNKNTLKFDSDDVTVQFDGVNARIHLSAL 1470

  Fly  1579 LKWDANRDPSQRLGLLAEY-NSPGTKHYDG-NLMITYPE 1615
            .:       :|:.||...| |...|:.||. |...|.|:
 Worm  1471 YR-------NQQCGLCGHYDNEKETEFYDAENQENTIPK 1502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 136/704 (19%)
DUF1943 665..1012 CDD:286281 65/382 (17%)
DUF1081 1029..1122 CDD:283982 16/97 (16%)
VWD 3741..3908 CDD:295339
C8 3951..4014 CDD:285899
vit-6NP_001023276.1 Vitellogenin_N 34..646 CDD:279663 138/708 (19%)
DUF1943 679..979 CDD:286281 67/389 (17%)
VWD 1339..1495 CDD:214566 33/165 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23345
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.