DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and Ccnf

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:NP_001093944.1 Gene:Ccnf RGDID:67401 Length:780 Species:Rattus norvegicus

Alignment Length:675 Identity:139/676 (21%)
Similarity:214/676 (32%) Gaps:240/676 (36%)


  Fly  2915 RNTQNFNLTGEL--HSRATLKAQDFKVV-AIH-------PNRAVV-LSTKYEDVSPEVVRHHSKL 2968
            ||....:|..::  |....|...|...| |:|       .|.|.| .|..::::.|.    ...|
  Rat    28 RNLTILSLPEDVLFHILKWLSVGDILAVRAVHSHLKYLVDNHASVWASASFQELWPS----PQNL 88

  Fly  2969 ELSETAWIGYNLELGNFS---KVG-----NESQSFALEIFYPKRNLSSSGQYYMTD-TNFNSDLS 3024
            :|.|.|     .|.|||.   |:|     ||..|.:.|.......|.:|..:.|.: .|..|| .
  Rat    89 KLFERA-----AEKGNFEAAVKLGIAYLYNEGLSVSDEACAEVNGLKASRFFSMAERLNTGSD-P 147

  Fly  3025 FQWLGGNYDQQP---------KIIHSNLQ--------WKAEPLH--------RGDREHRTIALTV 3064
            |.||   :.:.|         .::|.:|:        .||..||        ..|.|.|    ..
  Rat   148 FIWL---FIRPPWSVSGSCCKAVVHDSLRAECQLQRSHKASILHCLGRVLNLFEDEEKR----KQ 205

  Fly  3065 AHPLLEKDIN--CKATYYRGLRDLLRTHLTIDYSEYPDQLIELGAQLTDRYSELGHTNYTFHVYG 3127
            ||.|.|:..:  |.|:.|.    |..:...:|.|: |.:.:....:|.| |:..|...... ...
  Rat   206 AHNLFEESAHQGCLASSYL----LWESDRKVDMSD-PGRCLHSFRKLRD-YAAKGCWEAQL-ALA 263

  Fly  3128 KHIASELDVQLNGTLAAMNSYYKTESTAHYKRDIFPARYGKFLALLDVNKRELEYERQSPFHAVR 3192
            |..|....:.|.|...       :||....           |.|...|||:::        .:|:
  Rat   264 KACAGGSQLGLEGKAC-------SESVCQL-----------FQASQAVNKQQI--------FSVQ 302

  Fly  3193 LHLLPTIRYPIYGLNATIWDTPDTNHSGYIYMDILERYARM-DF-----NLTEDASQNLQMVGYI 3251
            ..|..|:|                    ||.:|.|...|.| ||     :||.:.          
  Rat   303 KGLSDTMR--------------------YILIDWLVEVATMKDFTSLCLHLTVEC---------- 337

  Fly  3252 PDTRSAFLDIWRNYEEIRVIDVSSYLKMNHSRLITGRFHWRPSIRQEVREKIQAVGKS---VYSS 3313
                                 |..||:   .||:.             |.|:|.:|.:   :.:.
  Rat   338 ---------------------VDRYLR---RRLVP-------------RYKLQLLGIACMVICTR 365

  Fly  3314 FSEGIDFWIKSIYTETTESMGVVWNTAKEYN-RDFIDDIGQ-LSVLEEDLADLRLFVNQSYEAND 3376
            |          |..|.......||.|...|. .|.:..:|: :|.||..:.              
  Rat   366 F----------ISKEILTIREAVWLTDNTYKYEDLVRVMGEIISALEGKIR-------------- 406

  Fly  3377 FYIKNVVNFTLTILDELAIRDHIESLPKIFSELWQAMGDSGKALRNSIVWLIETIKTTY--NNLL 3439
              |..||::...:|..:.:....:.|.....||                .|:.|..:.|  ..|.
  Rat   407 --IPTVVDYKEVLLTLVPVAPRTQHLCSFLCEL----------------TLLHTSLSVYAPARLA 453

  Fly  3440 DA---VARFFHGESLVYISGLLEKGIAKYDSF---IKDLHIKFIKYIENLWHKTWTLAENHWK-- 3496
            .|   :||..||.:..:.:.|.:.....|...   :..||.|       .:|..   |...::  
  Rat   454 SAALLLARLMHGHTQPWTTQLWDLTGFSYSDLTPCVLSLHKK-------CFHDD---APKDYRQV 508

  Fly  3497 ---AVLKRFEPHLFKMISFIETTAW 3518
               ||.:|||...::.||..|..::
  Rat   509 SLTAVKQRFEDKCYEEISQEEVLSY 533

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755
DUF1943 665..1012 CDD:286281
DUF1081 1029..1122 CDD:283982
VWD 3741..3908 CDD:295339
C8 3951..4014 CDD:285899
CcnfNP_001093944.1 Nuclear localization signal 1. {ECO:0000250} 20..28 139/676 (21%)
FBOX 35..73 CDD:197608 10/38 (26%)
Cyclin_N 281..406 CDD:278560 42/221 (19%)
Cyclin_C 425..531 CDD:281044 27/132 (20%)
Nuclear localization signal 2. {ECO:0000250} 568..574
PEST 582..761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T131220
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.