DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and LOC100496911

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:XP_002941105.3 Gene:LOC100496911 XenbaseID:XB-GENE-6038543 Length:3873 Species:Xenopus tropicalis

Alignment Length:4707 Identity:901/4708 (19%)
Similarity:1615/4708 (34%) Gaps:1540/4708 (33%)


  Fly     9 AIWLLLLIAHTQAVRENPLKDPRICGRPQCDSKSAKFNYGEQLYKYQYTVAVRTEFAGSGDNSSD 73
            |:.|.::.|......:...:|...|......:....|..|.: |.|.|:.:..|..|.|.....|
 Frog     5 AVLLCVIAAGFMGKAQEISEDSGSCMSDCPGTGQLNFQKGSR-YIYSYSTSTGTFLAESSSARRD 68

  Fly    74 LLLKSDLEIFFPKPCEGYLRINDAKLYDTLDELNDNESDSSEKTKEYDYYDNLANEESESQNYDN 138
            |.|:..:.|.....|...|::.|.|:..|  |:::|.|...|..::                   
 Frog    69 LSLECAVHIEVIGKCHMVLQLKDMKVRTT--EMSENSSKEFESLRD------------------- 112

  Fly   139 MHPKSSDFNVDLTKNLLRFAFHDGLISEVCPQEQETPWVLNIKKGILSAFQNTMMRFDVDANTTE 203
                      .|.|..|:|::|||.|.::||..||..|.||||:||||..|..:.......:..|
 Frog   113 ----------ALEKLPLQFSYHDGKIQKLCPSSQEPIWSLNIKRGILSVLQGNLKAPAAGRSIVE 167

  Fly   204 TDVSGQCQVQYALEDTDSSYVTIRKTKDINSCRQRYATHSVLQTTPYTFRDDKTIWPILKSQSHC 268
            .||.|:|...|.|...     ::.|.||::.|..|....:.:::...   .|||  .:|.|...|
 Frog   168 VDVLGRCPTSYELRGN-----SLWKRKDLSQCSNRVLGSTSIRSVAL---PDKT--QLLDSHLEC 222

  Fly   269 NLTIDNNVYKEIKCLETHLLVPFSNASSGALTTSTSRLKLDGVESYSAGEFLEQNPELVERR--A 331
            .....:....|..|.|:||:..||...:||.|.:.:.|||..:|:     .:..|.::..:.  .
 Frog   223 LQAFRDGTLTEATCDESHLVTVFSRDGNGAKTQTRTLLKLIRIEA-----DMSTNKDIPGKHYVT 282

  Fly   332 TLVFDHTPAVKPSHDEIKAARELLVEMCRVGFPNIQREFIDVFTNFLQTSKSLDYKTLSVLLQRS 396
            :|:::........|.|..|  |.:..:|..  |:...|..|:|.|.:...:.|....||.|.|||
 Frog   283 SLLYEKETIFGNLHGEDVA--ETVRNLCLA--PSTNYETADLFMNLVFELRLLSAAALSDLWQRS 343

  Fly   397 ASTCEQGRNHLLESLPFIGSTASYKVMRDQIINEKLTKQMAHDWMTALSFITRPDEETLETFHSI 461
            :..|......||::||..|:.|...:|:|.::.::|..:.|..::.:|:|:..|   |:....|:
 Frog   344 SFKCRDNWQPLLDALPSCGTEACVGLMKDILLAKELENEKAESFLWSLAFLPEP---TVGMVGSL 405

  Fly   462 LEYAKNRLDAEYT--LGATAVVHSFCKHHEACEENLRVQQIINLLETEFLNLYNLFKGERRTRER 524
            :...:.. ||..:  |..||::|.||...:.|.:...||.::.:|:.:..:  |....|.....:
 Frog   406 VPLLQEE-DAGQSVYLAITALLHHFCSITKECHKVPEVQTVMGILQEQLGD--NCTAQEDEQIHK 467

  Fly   525 MVILLKGLGNIGVVSSAFAEQLQWIIREDEAPVDIRLHGILAFRRVDCARHRSYFLDNYGNYTLN 589
            |.::||.:||.|:.:.:....|.........|..|||..:.||||:.|:.:|:...:.|.:...|
 Frog   468 MQLILKAIGNAGLAAESLIPVLTSCAFLRSNPDSIRLAAVEAFRRIPCSANRTILAELYQSVHKN 532

  Fly   590 SELRIYSYLQAMRCPDYISVGVIKSILEHEEINQVGSFVWSHLTNLAKSNSPVRIEAQGLLLNDE 654
            .|:||.||..||:||....:.:::.:|:||:..||||||||||:.|.:|:.|::.:....|.:|.
 Frog   533 EEIRIASYYTAMKCPTQEFLHIVRQMLKHEKSMQVGSFVWSHLSQLLESDDPLKQDIADSLPDDI 597

  Fly   655 LSERFKMDIRKFSRNYEHSLFFDEYNFGTTTDANVIFGTDSYLPRIASVNFTADLFGQSVNFFEF 719
            ||:.|:.:..|:| :|..:....| :.|...:|::||...|::||.|..|.|....|:::|..||
 Frog   598 LSKDFEGEFWKYS-SYSDATVLSE-SAGANVEASMIFTPSSFIPRSAMANLTIHAMGRAMNILEF 660

  Fly   720 TARAEGLEELAANAFGPKGPLSGQLLRKKLSFLNRWLGNESAEEDDTLENLLSLDNLR--LKRKA 782
            ..|.|..|:|....||.....|.:...:|        ..|:......:|.:...::.:  .||..
 Frog   661 GIRLENAEDLLKRMFGHPSFTSNKAFVRK--------DEENTNSGTPIETMAKANDKKPTSKRYT 717

  Fly   783 QEQARASEEEVDEDYDFEESLEGNKRQK-RDVSTTRKQEIDRNVDSLGYKLKYDYNNPRAQFGLR 846
            ..:..|.:.:..:..:|:.|....|..| .::    :|:..:.:.|:..:||       ....::
 Frog   718 HGEPPAKKPDQQKMKNFKHSCPSGKYNKINEI----QQKFTKGMKSITNELK-------CGLSMK 771

  Fly   847 VFGNDLRYFNVESLVEV-----MALAAKFNPFQQAKNVLSGKEFTYTKSRVFLDASYTVPLAVGL 906
            :|||:|.:.:.|.:.:.     :::|      :.|..:|.|:|..|:|.........|.|...|.
 Frog   772 IFGNELNFLDCEGVKQTIKQYSLSMA------ELAVRLLKGQEVQYSKRMGLATEEITFPTLSGF 830

  Fly   907 PLAIHAFGASSIDLRVSGNLDEMDPPTDWHFDVEGQFKPSVSVDVITTM-------QTDMFWEQS 964
            |:.:......|..:::.||   ||.....:|.:.|..|||..:.:.:.|       :..:.| .:
 Frog   831 PVQLSLNATLSTSVKIRGN---MDIKQQANFYINGYIKPSALIQLSSQMGIVGTVGKMGLRW-VT 891

  Fly   965 GIKVKSNLYSNSELVAKLKVRGRNLVSFSFDLPRDKNEIFSVRSELLVQKREEQLPQAG---IAN 1026
            |:|..|::....::     .:|:.|..| .:.|.:..||....|.|.      |:...|   |:|
 Frog   892 GLKAMSSVDGGIQM-----KKGQELKIF-LNTPDESMEILDFSSTLY------QVTPDGLKTISN 944

  Fly  1027 ---RSANSTCTWPVLDQAIGLQMCSHYSVPDLSNATEIYPSLL---LAGPLNFSLILKKSDLSAK 1085
               :.....|....:.:..|.|.|...|.|:       ..|||   |:||:..||:|:|.|...:
 Frog   945 PIYQKERKACMNEEVSKLFGWQPCLDVSYPE-------DESLLPFPLSGPVKVSLVLRKQDKGLR 1002

  Fly  1086 KYVFEYKWDQ--QEED---NNFSLVF--TTPGSKVPRVLVANVTKVPDAFNASVAFVNGPNRVSA 1143
            :|:.|..::|  |::|   |..:|.|  .||.|::.|                            
 Frog  1003 QYLLEASYNQIPQKDDWIPNEATLHFFMGTPKSEIRR---------------------------- 1039

  Fly  1144 GCSYDGNPDFRRLDIYLDTNGNRSLDLGMELR---RHQDFTAWIYNPRMLLAINGVNITGLAGTV 1205
                                     |:|::|.   :|:.|...:.:||..:.:||          
 Frog  1040 -------------------------DVGIDLHYNIQHRKFRITLLHPRKKIQLNG---------- 1069

  Fly  1206 KVNEKNGIKQHDVDLSFETKKLQ--------------------AVIKGNVVQSEITTSTNMT--- 1247
            |:......:...::|..:.|::.                    |.:|.....|.|..|.|:|   
 Frog  1070 KIESSRNSRNGHLELILDDKEIYYIKGLTDLQTAGGEQRYTALAEVKLTKFGSPIILSGNLTKQF 1134

  Fly  1248 ---IKYRFQANK-IEEINFAGKLVNNGDKSKTEYRGNMKLQTSAYPKLNFASESTWLSLQGHTEG 1308
               :.:.|..|. :::..|...::   ||...:......|:..||....|.|.:..| ||  ..|
 Frog  1135 GKKMAFSFALNNLLKDTAFLSVVL---DKKADDKLKQYSLEGEAYIPGVFGSYAIGL-LQ--KRG 1193

  Fly  1309 MITYNNAPDYVNPNYTSLVRLIFA-------RSHSEDSFLDGTQTRASLELKLPRSKID-YRILV 1365
            .|            :|:.||:.:.       ..|..|:         ..::|:..:..| |::.|
 Frog  1194 DI------------WTNAVRVKYGLLGDAKYLQHECDT---------GQKVKMDTNSDDQYKVDV 1237

  Fly  1366 KHKEHIKNGTEHNVIVGLKYTPEKEITGLFSV-------HLPRRN----LFAIDAYMNVTVPEFN 1419
            :|:.|.......|..|.|.:  |:.|:.:.|:       |....|    ||....:...:.|.  
 Frog  1238 EHEFHCTQMPSFNHKVHLNH--EERISHIHSMLEVSYGKHWDEMNNKKKLFISQTFKYYSSPS-- 1298

  Fly  1420 SCTAS------LKVNEKATKDYIIFINGSWFTGHSVAVKANYKDRSSRVQALHHLKMIVESPSFN 1478
              |||      |:|:||                     :.||     |.|.:|....:..:.:|.
 Frog  1299 --TASYFMEFTLQVSEK---------------------QVNY-----RTQLIHTHSALESNTNFK 1335

  Fly  1479 ITSLNIIYRRKQLLIFYDIQAKYDQDPYGLTIQYASNAHNRNTNAEVRLKVKERDYWINAKLLSE 1543
            :.              |:     |:.|:...:|:...:.|.....|....:.....::.:.|...
 Frog  1336 MQ--------------YN-----DRIPFVSGLQWKDTSKNDLQKWEGAFTMDTPWLYLYSALKRY 1381

  Fly  1544 QPKLLQLEIHMDKIRDVHIQVGLLNVDKRKELSLELKWDANRDPSQRLGLLAEYNSPGTKHYDGN 1608
            ||:....:.             ::.:...|.|::           :.|.|...|...|::. :|.
 Frog  1382 QPQRYAYQT-------------IIEMSAGKALTI-----------KNLVLDMFYKDKGSEK-EGK 1421

  Fly  1609 LMITYP------ERTIHF-GFNSFTGGPKYFGKVHASWSINEVIEFEYEAGILPGHTLHNWVKAE 1666
            :.|..|      ..|::| |.|||    :.:.::.:.|  |::::.|.:        |.|..|.:
 Frog  1422 IHIHTPTATYLRASTVNFIGGNSF----RSYSEMVSLW--NQLLKNEIQ--------LENNEKIK 1472

  Fly  1667 LRTPFDGWRVNSLDAGIYSLKNLILVNSTLFWADDQKLQVGYKSDYDVNDQLMSFDVRFGINSTI 1731
            |              .::.:|                   |.|.:::|:....|.|.....|.::
 Frog  1473 L--------------FVFKIK-------------------GSKQEFNVSAGYRSIDWPKKSNFSM 1504

  Fly  1732 RDIPTINVKVKHWMDVKKVDTELYLGYSGQNDTFNTYSMDSSWEIEKNQRYNNYSGLVHLVSPFK 1796
            :.:         |.|.|..  .|.....||.:           |::|::......||::|..|||
 Frog  1505 KTM---------WTDQKSY--PLIFQLDGQIE-----------ELKKDKMLYQKQGLLYLRHPFK 1547

  Fly  1797 GYEKGGLVAHFSLSDQRVVSGAASLNFDLREFTLTMNGYVKKFTDNMLTVNITTPLEKFGTINAR 1861
                                                                 .|:.:...:...
 Frog  1548 -----------------------------------------------------VPVPQSILLQET 1559

  Fly  1862 FGLNEKKRHAVAEVR---------APTAALGVE-----VLADIKNLLNFDV-----KLSVATPIE 1907
            |.::::|||.:.|.:         ..|..||..     :.||:::.....|     ::..:|...
 Frog  1560 FTVDKQKRHYMLETKLLMDEMEECVQTITLGYNADNPYICADLRHPYKHQVFPNNLEICASTKRH 1624

  Fly  1908 SFQQAAIFALFNPERVDMRGLWNNVTLGFTG----------VWHMQNITDFEYSYHVFTPLAGFE 1962
            :..:..|.|.....:       .|| .|.:|          :||:..: |..:|:.:..|.|...
 Frog  1625 NLGKTEIEATIKANK-------RNV-FGLSGTFQNKSSKRELWHVLRM-DMTHSFQLRIPRALIF 1680

  Fly  1963 ENGFIVQLLKRKEFVFQLHGKM-----SNYKLGVKINGEPKSDLVNQLGSNKMELEMLYDADFKP 2022
            :.....:.:|:.||...:.||:     :..:|..::|     ..:||:|                
 Frog  1681 DGEIFSRHIKQDEFNHGIWGKLIINRNNTLQLHAQLN-----RTLNQIG---------------- 1724

  Fly  2023 LNAETDYKPDADEEYFSYFT---------NFQVD---------------TLVW------------ 2051
                          :|||||         |.|.|               ||.|            
 Frog  1725 --------------FFSYFTHPFALRIPHNIQADATMKRYGTRDVNGTFTLHWGKEVLLFEVDLN 1775

  Fly  2052 --------------------------------------------PTIVGNVDI---------QEI 2063
                                                        .|||.|..:         |::
 Frog  1776 NDSRTNIGIIGLSASLHQTVLADPLTAHLRITGKALPSRFSLLSETIVNNQSLLIELLGSKEQKV 1840

  Fly  2064 -------------IDFYLVVGHVELPQGKVEFKDRLH------------YPDYINVHNLLTVTTP 2103
                         |:...::.|..|.:|.::.|..::            |..|:...|:....|.
 Frog  1841 GLVFSFSGNLIHTINGLTILPHQLLIEGSLKQKKNINEGYISFLKNQEFYRIYVRNRNVFGNVTQ 1905

  Fly  2104 FAVAKNIKSIVEYHV--DLNFNAFYERVKFIVN-------DDK----------DNTQE--LG-FV 2146
            ..:..|:.....:.:  :....|:.:..:...|       |:|          |:||.  .| .|
 Frog  1906 HNITFNLSQNGSHSMPAETKLRAYVQLEELDKNGEVCIQADEKLLCMDLSNSGDHTQRGVTGKLV 1970

  Fly  2147 FNYTALQDNVKPKAHDVQVTL----------------------------LTPYEMLHEIYVHGHI 2183
            .|..:||:...|.|..|:|||                            :.|...|.....|...
 Frog  1971 HNLFSLQNAGIPMASAVEVTLQNTSNNRTFSIALDNGKSRVDISLGLERILPGSQLTARLKHNVG 2035

  Fly  2184 ELDDNAYKGNISAVTAHTHLSMAASIENEDNFLETSVGIQLETDAIPHYGCQVYFK--------- 2239
            :|..:....||:.:..:         ::.|....|.:.:|.|.:   |...::..|         
 Frog  2036 DLKFHGLPYNINGICYY---------QSADKGFVTGMAVQAEDE---HIKAEMNKKTTGNTSNII 2088

  Fly  2240 ----KDFSAVDKAIDIRFEVTDNGTLNQLHISTDWHTDPSYIVNANGRI--KTTM--LPLQMAST 2296
                .|.|:::..|....::|.||..          |...:..:.||.|  ||:.  :||:....
 Frog  2089 LSLQNDLSSINYIIPSSMKITCNGEF----------TSSLFYGHCNGDIARKTSQFSIPLRTTFN 2143

  Fly  2297 SVLVIQG--------------------------QN----------PHLNFDLNLLSQN------- 2318
            ..|:..|                          ||          |.| :.|.:...|       
 Frog  2144 GSLLANGYKTNLFGLVSTGDEFGRMTINTESGLQNTIEIGFKHALPQL-YTLGITKDNKIRISAT 2207

  Fly  2319 --GQS-----IAYG-------ARANKKKD-----------VFNIEVWTPMKNF-RNISMHGTAIR 2357
              |::     ||.|       |.|.::.:           |||....|...|. :|:.::|:..|
 Frog  2208 RQGKTGTVVDIAIGKCLIKASAEAREENNGSETILNWTTSVFNSCFLTEKFNIPKNLLVNGSLQR 2272

  Fly  2358 SPRDPGRYDVSGFLYRNMATYEVTGA---VRMTNSLPIDVVLRVQPKAGGRDGVIELNIHEAG-- 2417
                    |:.||.......|:...|   |:.|.: |..|           :|.:...||...  
 Frog  2273 --------DLCGFGLAIQIGYDENNANLLVKKTCN-PYFV-----------EGSLNHTIHYLNVL 2317

  Fly  2418 --PKKIRFSFSA-----------IEDGKMCQ-------MSGGY--------------------SV 2442
              |...:|.||.           ::.|: |:       |||..                    |.
 Frog  2318 GLPSVNQFLFSTSTTPTLGGHIMLQSGQ-CRIGATADVMSGNKTEWMLLTETDCKPLKALHIPSQ 2381

  Fly  2443 SKTNGAMDFSVLVESTEPE-IARINFYGNLSPNSEGSLVGDLSLET---PWKALGIDTVH---LH 2500
            |:.||    |:.:...:.| :..:.|.||.|         :|.:.:   |...:.|:..|   |.
 Frog  2382 SRVNG----SLAINGCKVELLCALTFNGNSS---------ELHVRSECQPKMKMEIEFRHNLFLL 2433

  Fly  2501 SDVGFLNKGGHIVGE---YKIGQYIGRGSCLW--SWILAEDMQLVLENYLERPNAKPRIVHASAK 2560
            ..:...||...|||:   |.|...:..|||.:  ...:..|.:|.|:.:||              
 Frog  2434 KGISEENKMSVIVGKLSNYNIEMLLQSGSCAFEIKGDIHTDNKLQLKMFLE-------------- 2484

  Fly  2561 YQNPGQTFTQL------QAGGRLSVDSKWNLD-----------------VNGSAEYKSVDDFKFR 2602
              |..:|...|      ...|.:.|:.|.|||                 :..|.:.:.:|    .
 Frog  2485 --NKCKTMQDLGVPHKIDGSGYIVVNKKANLDSQMLIVVDESTLQGLLILKASEKKQELD----A 2543

  Fly  2603 VIT-----ALPLPVGDRHQL------SASYQGNVISQQFNNPDFVLEASYESFEAQNKLLSRISY 2656
            ::|     ||.|.|..:..|      |:.:....|....:|.....|.|:........::.:|.:
 Frog  2544 ILTHNIQPALNLGVPKKAVLDMTTERSSEFYKRSIQLSLDNKQISEEMSFHQKADHISIIYKIIH 2608

  Fly  2657 K---------------NATNNLKGLGHVEWGKIQNLSVVEGDFELLHKQGAQREFSAKIITPKFK 2706
            .               .||.:||        :|:|:||             ...:.::::....:
 Frog  2609 NLDILKKIHLEDRLDIEATVDLK--------EIRNISV-------------STHYGSRVMNASVQ 2652

  Fly  2707 ---NEHTFALTGSYDLEKSGHHNVVGSLD--YPASRRIT--------DLDVSVSSLS-------- 2750
               ||....||||.      .||....|.  :|||.:::        :.:|::.:.|        
 Frog  2653 IMGNETRTNLTGSI------LHNWPWLLQNKFPASLKVSVGMQATEDEQEVTLQTASAETWLTCT 2711

  Fly  2751 ------------NMHGIFNSTLPTFLNVSWLKTDFNFTTNNGKSYRYCRCFWPQDTAYFKLNSNY 2803
                        ::..:.||.:  ||...:.|.    ...||   |.|......:.:...|..::
 Frog  2712 VALLGKADESKVHIRSMHNSDI--FLKYGYPKV----VILNG---RLCTLCLEGNRSSITLGVDF 2767

  Fly  2804 DSDSSNF----------NHNLNGNVE--------IEVPLAT-----------------------R 2827
            .....|.          :.|:|..||        :.:|..|                       |
 Frog  2768 GKKILNLDVSALRDQPGSININAGVEHSIHVLRILGIPSITQMVLQLISTNKNLGGNWKLICDRR 2832

  Fly  2828 HRADIVYGLQKRRNQDAGNVKVVYN----EKQVLDGKYKRLEQAKAPIYKETTDISLENEVKPLG 2888
            ....|....:.::.:|..|:|||:|    ::.:.:..| .:.:....:.:....:.|:.:.|.|.
 Frog  2833 THIFITASTRTQQQRDEVNIKVVHNVPFLQRYIPNSSY-LITKVSYSMNEAGASVLLKIDEKELK 2896

  Fly  2889 IHFVSTRDASDPAGSQDVKH---------IEIYELRNT-QNFNLTGELHSRATLKAQDFKVVAIH 2943
            :..:.....|....:..::|         .:| |:|.| :..:.|..|.......:::..::||:
 Frog  2897 VSTMLNITVSSYTSTVQLEHTVPQFKNVPAQI-EIRTTFEKSHKTCALRQETIWGSKEVTLMAIY 2960

  Fly  2944 PNRAVVLSTKYE-------DVSPEVVRH--------HSKLELSETAWIGYN----LELGNFSKVG 2989
            ..:...||..:|       .:.|:.:||        ||.....:...||:|    ..:.:..|:|
 Frog  2961 TGQFPKLSGGHEVMGEFSQSLFPKTIRHGKVKIYLEHSVHNHQDHVTIGWNGRDQAGISSLLKIG 3025

  Fly  2990 NESQSFALEIFYP----KRNLSSSGQYYMTDTNFNSDLSFQWLGG-----NYDQQPKIIHSNLQW 3045
            .|.....:.|.:|    .|:|..|.......:.:|......|..|     ......|:::.:..|
 Frog  3026 KERFDCRVGISHPFNFSVRHLEISSLSEKRGSKYNHQTQVAWNKGFPVNLRLTLDDKLMNDSKVW 3090

  Fly  3046 KA--EPLHRGDREHRTIALTVAHPLLEKDINCKATYYRGLRDLLRTHLTIDYSEY----PDQL-- 3102
            .|  ..|....::..::....|...:|||.|....|...:.:..:...|:.|.::    ||.|  
 Frog  3091 NACVSILPGQIQQLISVGNIQACGYMEKDSNAFQEYMDLMWNSKKFKQTLMYEKHIDGGPDTLQL 3155

  Fly  3103 ------------------IELGAQLTDRYS-----ELGHTNYTFHVYGKHIASELDVQLNGTLAA 3144
                              .::|....|...     ||.:..:...:.|||..::.::.::....:
 Frog  3156 EAIFENIFPADCSKHHISAKMGTNYLDTVDHVLKLELCNLQHPVVISGKHSLNKEELIMSENRLS 3220

  Fly  3145 MNSYYKTESTAHYKRDIFPARYGKFLALLDVNKRELEYERQSPFHAVRLHLLPTIRYPIYGLNAT 3209
            ..|..:.::.              |:..||...|    :.|...:::.|||              
 Frog  3221 FTSNERDDAV--------------FILALDETGR----QEQEQNYSISLHL-------------- 3253

  Fly  3210 IWDTPDTNHSGYIYMDILERY----------ARMDFN----LTEDAS-----------QNLQMVG 3249
                   ..|..|.|.::.:|          .:..||    ||.:||           ||:|   
 Frog  3254 -------KASESIKMGMIGQYLSSSSEHEVQLQTTFNENDLLTLNASSGKTCIQVNVVQNIQ--- 3308

  Fly  3250 YIPDTRSAFLDIWRNYEEIRVIDVSSYLKMNHSRLITGRFHWRPSIRQEVREKIQAVGKSVYSSF 3314
              ..:....|::....:...:..|::||::|                 .:|:::   |:.|.|:.
 Frog  3309 --GSSEEKGLELSACTDSQYLAAVNTYLRVN-----------------GIRDRL---GQLVLSAS 3351

  Fly  3315 SEGIDFWIKSIYTETTESMGVVWNTAKEYNRDFIDDIG---QLSVLEEDLADLRLFVNQSYEAND 3376
            ::.:.|:    |....|::      ||..|  .:.:||   :..::|         :|:..   |
 Frog  3352 NQSLSFY----YQGCGEAI------AKAEN--LLGNIGLHVKTHIVE---------INKKL---D 3392

  Fly  3377 FYIKNVVNFTLTI-----LDELA---------IRDHIESLPKIFSELWQAMGDSGKALRNSIVWL 3427
            .|:|   .|..|:     |.|.|         |...::::||.|:::|:..| ..:|||:.:...
 Frog  3393 TYVK---GFQRTVQEYEFLHEAAGWPSKISQDIAGVLQNVPKSFNQMWKQSG-LRQALRHDLPIY 3453

  Fly  3428 IETIKTTYNNLLDAVARFFHGESLVYISGLLEKGIAKYDSFIKDLHIKFIKYIENLW-HKTWTLA 3491
            .|.:    |||:..:..... ..||.:..      |.||:.:|.|        |::| .||.|  
 Frog  3454 FERL----NNLVKQMQTELQ-RPLVTLKD------AYYDATLKPL--------EDVWQEKTET-- 3497

  Fly  3492 ENHWKAVLKRFEPHLFKMISFIETTAWNLSKEVFDFIYKRTNELAESPYFNKVSSFTADAE---- 3552
               |...:..|.|.:.|                        :|....|....|.:..|..:    
 Frog  3498 ---WLRKINAFLPSIVK------------------------DEWLMDPVRRLVDALKAGLDVGTH 3535

  Fly  3553 --RLYRDFKANDAITNIKK-------YS---TIAWNF--VKEKYFKLVPFGAELNEVLTE--IWQ 3601
              ..:.|.|.:.|::.|:|       ||   |:..||  :..:|.  |...|.:...:.|  :.:
 Frog  3536 QLLKWTDAKLSRAVSKIRKPLTRLFSYSSNCTVMLNFPLLPREYH--VTGLANITHYIIEEKLMK 3598

  Fly  3602 EIKELEKIDQVQIMVQKYYEVMAKVDWVADELQLEHRLHQVYGLVRNKFRNYAMNALETADMYRE 3666
            .||::..|:    ::.:||                            :|:...|.:         
 Frog  3599 PIKDMYSIN----LMAEYY----------------------------RFKRRMMES--------- 3622

  Fly  3667 AKTKFVFDPEVGIIDLEQKLPMSWHAFNETPRFEEIPEYQVLAKAQSFFSETNSSIVMKLYNMRT 3731
                                |..:|                                        
 Frog  3623 --------------------PFEYH---------------------------------------- 3627

  Fly  3732 HLDPKTWLPPYYSRALLIDSRHYMTFDQRYVGLNLNFDELGNGRSTSQCSYLLAHDFFKRNFTLL 3796
                          |:||.::|.:|||    |:.||.        .|:||.|||.||....|||:
 Frog  3628 --------------AVLIGNKHVVTFD----GILLNV--------ASKCSLLLAKDFMYNKFTLI 3666

  Fly  3797 LEPASKSLAGQGLTRKLSFIANGQLIEIDLETDHISINGNPQPI-LPLKLGDVNIHRDLDVLSIT 3860
            |.      .|.|..|.|....|.  :.:|:... :.|..|.|.: ||:....:.|.:|.:.:.:.
 Frog  3667 LN------QGGGTMRSLHVDMNH--VSVDIYPG-LKIEENCQRLDLPVYKNGIFIKKDANHIEVA 3722

  Fly  3861 SDTEFSLHCNVQFDLCWFEVSGWYFGRTAGLLGTLNNEPYDEYTMSSGVISNETQLFTDSWSL-K 3924
            :....::.|::..|:|.|.:.|||.|.:|||.||.:||..:::.:.....:|.||.|:..|.: .
 Frog  3723 NQEGITVQCDIYHDICSFTLEGWYHGISAGLFGTNDNESGNDFLLPDHSHTNSTQDFSLKWQVDT 3787

  Fly  3925 QCRQNKLAQTQEVSQEVSDACTSFFR--TGILATCSAVLDPTPFYEMCMDLGMKSPPIRKGHPAV 3987
            ||...:.......:......|.:.|:  ..:|..|..|:.|.|||..|::....|..|       
 Frog  3788 QCSSGRKKIKACPTSPHQKLCKALFQGSNSVLRNCFRVIYPQPFYNACVEDICDSNEI------- 3845

  Fly  3988 KGACAAALAYIEACTALKVPMRVPSQC 4014
            |..|..|.||:..|....||:.:|.||
 Frog  3846 KPICNLAAAYVHLCNRNFVPIEIPLQC 3872

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 163/588 (28%)
DUF1943 665..1012 CDD:286281 78/362 (22%)
DUF1081 1029..1122 CDD:283982 29/103 (28%)
VWD 3741..3908 CDD:295339 50/168 (30%)
C8 3951..4014 CDD:285899 20/63 (32%)
LOC100496911XP_002941105.3 Vitellogenin_N 41..575 CDD:279663 164/591 (28%)
DUF1943 608..932 CDD:286281 78/361 (22%)
VWD 3628..3770 CDD:295339 50/163 (31%)
C8 3804..3866 CDD:285899 20/69 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0008740
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.