DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and apobb.2

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:XP_002665852.3 Gene:apobb.2 ZFINID:ZDB-GENE-070705-554 Length:2633 Species:Danio rerio

Alignment Length:3319 Identity:652/3320 (20%)
Similarity:1137/3320 (34%) Gaps:1049/3320 (32%)


  Fly     1 MGGLKPQAAIWLLLLIAHTQAVRENPLKDPRICGRPQCDSKSAKFNYGEQLYKYQYTVAVRTEFA 65
            ||..|.:..::..|:|.             .||.|.:..||...|...|.|......|       
Zfish     1 MGDHKLRLLLFFSLIIL-------------SICRRFKPLSKHEYFYETESLNSLNKQV------- 45

  Fly    66 GSGDNSSDLLLKSDLEIFFPKPCEGYLRINDAKLYDTLDELNDNESDSSEKTKEYDYYDNLANEE 130
             :|..:|     ..:||..|...:..||..|.||              ||.|.          .:
Zfish    46 -NGPKAS-----CRVEILVPDASKYILRTTDCKL--------------SEVTA----------VD 80

  Fly   131 SESQNYDNMHPKSSDFNVDLTKNLLRFAFHDGLISEVCPQEQETPWVLNIKKGILSAFQNTMMRF 195
            :|..........:.||..|:.||.|:|....|.| .:.|::.|...:||||:||:||....::..
Zfish    81 TEGNPVFGKAAAAEDFRTDMEKNPLKFTVTKGEI-RLFPEKGERANILNIKRGIISALAVPLLEE 144

  Fly   196 DVDANTTETDVSGQCQVQYALEDTDSSYVTIRKTKDINSCRQRYATHSVLQTTPYTFR--DDKT- 257
            |...||  ..:.|.|..:|.: || ::.||:  .:|::.|.:              ||  :|.| 
Zfish   145 DRKKNT--PSIYGLCMTEYTV-DT-ATAVTL--NRDLSRCDK--------------FRPIEDHTS 189

  Fly   258 -----------IWPILKSQSHCNLTIDNNVYKEIK------CLETHLLVPFSNASS-GALTTSTS 304
                       :..:::|...||...|    ||.:      |.|.|:|||||:... |...|...
Zfish   190 PLALITGLSHPLAQLIRSNQTCNYKFD----KEQEHMTSAICTEKHVLVPFSHKGEYGVTNTGKQ 250

  Fly   305 RLKLDGVESYSAGEFLEQNPELVERRATLVFDHTPA-VKPSH----------DEIKAARELLVEM 358
            .|.|.||        .|.|..        ||||..| :||.|          .:.:||..:|   
Zfish   251 VLTLLGV--------TENNDR--------VFDHNIANMKPLHLDRSVDISPVQDKEAALAVL--- 296

  Fly   359 CRVGFPNIQREFIDVF-TNFLQTSKSLDYKTLSVLLQRSASTCEQGRNHLLESLPFIGSTASYKV 422
                     ||..|:: ||..:....|.||.::|:.:..|.|.   |..|.|:|. |..:.:|:.
Zfish   297 ---------RELADLYKTNSGRKRAHLAYKLVAVIRKMEAETL---RAALPEALG-ISRSLTYQA 348

  Fly   423 MRD-----------QII-----------------------NEKLTKQMAHDWMTALSFITRPDEE 453
            :..           |||                       ::.|.|:|.   .||....:||   
Zfish   349 LLQCGTPKCSSAIMQIIRTFDKSSFEVDAAVYAIGIIPQTSQVLVKEML---ATAKIKPSRP--- 407

  Fly   454 TLETFHSILEYAKNRLDAEY-TLGATAVVHSFCKHHEACEENLRVQQIINLLETEFLNLYNLFKG 517
                .:..|..|..||   | |.|.|:.:.:...:        .::||                |
Zfish   408 ----IYYALSNAVRRL---YETDGVTSEIQAVADY--------ALEQI----------------G 441

  Fly   518 E-RRTRERMVILLKGLGN----IGVVSSAFAEQLQWIIREDEAPVDIRLHGILAFRRVDCARH-R 576
            : ...:|.:.:.||.:||    :|....|....:...|.:..|...::...|..:|:...... |
Zfish   442 DCTGDQEHVFLSLKVIGNMVAALGAARPALHSAVIKCINQPGASPAVQQAAIQVYRQFPVPEEGR 506

  Fly   577 SYFLDNYGNYTLNSELRIYSYLQAMRCPDYISVGVIKSILEHEEINQVGSFVWSHLTNLAKSNSP 641
            ...:....:...:.:.|:.:||..|:.|....:..:.:.||.|:.::..||:.||::::..|.:|
Zfish   507 EVLMHTVLDKVASVQKRVAAYLILMKNPTPAELAQLAAALEIEKNHEAKSFIISHISSIMASTAP 571

  Fly   642 VRIEAQGLLLNDELSERFK-------MDIRKFSRNYEHSLFFDEYNFGTTTDANVIFGTDSYLPR 699
                 :.|.|...:...|:       |...:|||:|...          :.:.|.||.:...|||
Zfish   572 -----ETLNLRQNIQNAFQGNDIEMAMKSTQFSRHYRLG----------SLEGNFIFESPDNLPR 621

  Fly   700 IASVNFTADLFGQSVNFFEFTARAEGLEELAANAFGPKGPLSGQLLRKKLSFLNRWLGNESAEED 764
            ...:..|.:.||..::..|.....:|.|.:....||..|.....:::..|...::.    .||.:
Zfish   622 EVMLEMTLNAFGLDMDLIEIGMEGKGFEPILEALFGEDGFFPDIVMKSILYATDKM----PAELN 682

  Fly   765 DTLENLL-SLDNLRLKRKAQEQARASEEEVDEDYDFEESLEGNKRQKRDVSTTRKQEIDRNVDSL 828
            :..:|:| :|:|.|.||:|.:..                               .:||..:|:.|
Zfish   683 EVWDNMLPNLNNYRKKRQATQNI-------------------------------VKEISDSVNKL 716

  Fly   829 GYKLKYDYNNPRAQFGLRVFGNDLRYFNVESLVEVMALAAKFNPFQQAKNVLSGKEFTYTKSRVF 893
            ...||.. :.|.|...|::.|.:|.|.:.:. .:::....|..|....|.:.|..:.......:|
Zfish   717 SEDLKAQ-DAPEAMVYLKLLGAELGYLDAKD-GKMIGSLLKMIPTDFTKRLFSSVDNELFLHYIF 779

  Fly   894 LDASYTVPLAVGLPLAIHAFGASSIDLRVSGNLDEMDPPTDWHFDVEGQFKPSVSVDVITTMQTD 958
            :|..:.:|.|.|.||.:...|..:..::  |.|.......|:.|.:      |..|:::|.:.|.
Zfish   780 MDNEFYLPTAAGFPLRVALSGTFTPGIK--GGLSFNPGMGDFAFML------SAGVELVTEIGTH 836

  Fly   959 M-FWEQSGIKVKSNLYSNSELVAKLKVRGRNLVSFSFDLPRDKNEIFSVRSELLVQKREEQLP-Q 1021
            : .:..||:::.:|:|..|.|.||:....:.| ..|...||:..|:.||.:.|:.....:.|| .
Zfish   837 LPDYVHSGLEMHTNIYHESGLRAKISGTQKRL-KLSIPAPREPTELISVTNSLVSVVGGKILPIS 900

  Fly  1022 AGIANRSANSTCTWPVLDQAIGLQMCSHYSVPD--LSNATEIYPSLLLAGPLNFSLILKKSDLSA 1084
            |.:.....:.|..:|      ||:.|:....||  |::....:|   |.|...|::.::.|. :.
Zfish   901 ANVQYTMEDCTAVFP------GLKSCTTLEYPDAALNDNAPYFP---LTGDSRFAVEIRPSG-TV 955

  Fly  1085 KKY--VFEYKWDQQEEDNNFSL-VFTTPGSKVPRVLVANVTKVPDAFNASVAFVNGPNRVSAGCS 1146
            .:|  :..|.::.:|:...||: ...||...:..|::                    ||.....|
Zfish   956 TEYTAIIGYTYEDEEDKLTFSVKAEGTPFEVLNTVMI--------------------NRKLNTAS 1000

  Fly  1147 YDGNPDFRRLDIYLD---TNGNR-SLDLGMELRRHQDFTAWIYNPRMLLAINGVNITGLAGTVKV 1207
            .....:..:||..:.   ||..: .|:|..:|:                         |.||..|
Zfish  1001 MKLLMEALQLDHTVSGKFTNAEKLKLELQSDLK-------------------------LPGTTSV 1040

  Fly  1208 NEKNGIKQHDVDLSFETKKLQAVIKGNVVQSEITTSTNMTIKYRFQA---------------NKI 1257
                    ..:.|::|::|::|.:|.:.      .|...|:...|:.               |||
Zfish  1041 --------QTLILTYESEKIEAEVKSHF------NSKTRTLVPLFRTGDTIIIGLLTRQMGQNKI 1091

  Fly  1258 EEINFAGKLVNNGDKSKTEYRGNMKLQTSAYPKLNFASESTWLSLQGHTEGMITYNNAPDYVNPN 1322
            :.::...||        ..:.|.........|      |..:|::    :..:.|:    :..|.
Zfish  1092 KLLDIIAKL--------AAFSGVPATLDITLP------EELFLNI----DAAVKYH----FGQPY 1134

  Fly  1323 YTSLVRLIFARSHSEDSFLDGTQTRASLELKLPRS-KIDYRILVKHKEHI---KNGTEHNVIVGL 1383
            ||..:.|.          |.|..||   :||.|.: ..|..|:....|.:   :.....:|.:.|
Zfish  1135 YTITLPLP----------LGGKSTR---DLKFPTTLSTDLFIVDPDLESMQLPEVSIPESVTLSL 1186

  Fly  1384 KYTPEKEITGLFSVHLPRRNLFAIDAYMNVT--VPEFNSCTASLKV-NEKATKDYIIFINGSWF- 1444
            ......:::|....|     |:.:||.::..  ....:|.:|.||| .....:.:.:.:.||.. 
Zfish  1187 HAFQLADVSGKLRCH-----LYDLDATVSAARDPAAHSSYSAKLKVTGTSPVEQFCLQVEGSALA 1246

  Fly  1445 ---TGHSVAVKANYKDRSSRVQALHHLKMIVESPSFNITSLNIIYRRKQLLIFYDIQAKYDQDPY 1506
               :|.|  :||:             :|.::|...||.|                          
Zfish  1247 EATSGDS--LKAS-------------MKTVIEHKFFNAT-------------------------- 1270

  Fly  1507 GLTIQYASNAHNRNTNAEVRLKVKERDYWINAKLLSEQPKLLQLEIHMDKIRDVHIQVGLLNVDK 1571
             ::::       ....:..:|.||.:.......|::||                           
Zfish  1271 -ISVE-------EEVQSAAKLSVKSKSKLEVTSLVAEQ--------------------------- 1300

  Fly  1572 RKELSLELKWDANRDPSQRLGLLAEYNSPGTKHYDGNLMITYPERTIHFGFNSFTGGPKYFGKVH 1636
               :|:|.......|..|..|             ||||.            .||..     |.::
Zfish  1301 ---MSVEHNAIFEGDAGQISG-------------DGNLE------------GSFKA-----GSIY 1332

  Fly  1637 ASWSINE---VIEFEYEAGILPGHTLHNWVKAE---LRTPFDGWRVNSLDAGIYSLKNLILVNST 1695
            .|.::.:   :|..:.||.|      .:.:|.:   |:..      ||......:.:..:|..:|
Zfish  1333 GSGNLKQSVLLIPSKQEAKI------DSLLKVDSKLLQAQ------NSFSVAFANRELTVLSTTT 1385

  Fly  1696 LFWADD----------QKLQVGYKSDYDVNDQLMSFDVR---FGIN-----STIRDIPTINVKVK 1742
            .|  ||          .:.|:|           :|:..:   ||:.     .|..|...|:||::
Zfish  1386 AF--DDILTNTAKVAINESQIG-----------LSYYTKAQGFGLKIENTAETRADAKAISVKIE 1437

  Fly  1743 HWMDVKKVDTELYLGYSGQNDTFNTYSM--DSSWEIEKNQRYNNYSGLVHLVSPFKGYEKGGLVA 1805
            ...|:.:  ..:|...:|:.| .|..::  |:|.::..::..:|         ....:.|.||.:
Zfish  1438 TSGDLSQ--ERIYSIVTGELD-INGLAIKSDASAKLMGHRAAHN---------AILNFNKDGLTS 1490

  Fly  1806 HFSLSDQRVVSGAASLNFDLREFTLTMNGYVKKFTDNM-LTVNITTPLEKFGTINARFGLN-EKK 1868
            ..:.:.|.::|.....|        |.....||.|.|: ...|     .||  |.|....| |.|
Zfish  1491 SGTTTLQSILSQEKVKN--------TFEVIYKKLTANLQCKTN-----GKF--IGASIDHNTEMK 1540

  Fly  1869 RHAVAEVRAPTAALGVEVLADIKNLLNFDVK-LSVATPIES----FQQAAIFALFNPERVDMRGL 1928
            .:.              :|..|:|:|.|:.: |:|.|....    |.....||....|.|..||.
Zfish  1541 ING--------------LLGRIENILRFNSRILNVETNTRGTTVPFSFNFNFAANGSENVYNRGH 1591

  Fly  1929 WNNVTLGFTGVWHM----QNIT-DFEYSYHVFTPLAGFEENGFIVQLLKRKEFVFQLHGKMSNYK 1988
            :..   .|....|:    ::|| ..|..........||.......:...:.|.:.....:.:...
Zfish  1592 YRE---DFNTKMHLKIDPESITHSHECKISTLVETYGFYGVEVESEFQSKSELLLNPSEQKAKMA 1653

  Fly  1989 LGVKINGEPKSDLVNQL---------GSNKMELEMLYDADFKPLNAETDYKPDADEEYFSYFTNF 2044
            :.||:|....:..:|..         ||.|:...:|..||       .|::..|...:..|..|.
Zfish  1654 VKVKVNKHAINQEINAYNTPAQFGLEGSGKVFTNLLNTAD-------DDHQDFAVSAFLKYDKNN 1711

  Fly  2045 QVDTLVWPTI--VGNVDIQEIIDFYLV------VGHVELPQGKVEFKDRLH-------------- 2087
            |:.::..|.:  :|.|....|:.:..:      :.::.||:....|...::              
Zfish  1712 QMHSIYLPFVDSLGLVPSSVILTYSSIEETLAYLAYLSLPKHVSNFVSNMNFGRRAEQFQRASIA 1776

  Fly  2088 ----YPDYINVH----------------NLLTVTTPFAVAKNIKSIVEYHVDLNFNAFYERVKFI 2132
                ||..:.|:                |...:|....:.:|:..::..|:    ||    :.|:
Zfish  1777 LYQEYPLKLGVYEKQLSDMISQITEALSNFKQLTANGMLIENVDRMLTKHI----NA----LMFL 1833

  Fly  2133 VNDDKDNTQELGFVFNYTALQDNVKPKAH-DVQVTLLT-PYEMLHEIYVHGHIELDDNAYKGNIS 2195
            :.:|            ...|...:||:.| .:|:...| .|::.....:||.|......|..|.|
Zfish  1834 ITED------------VKLLLSLLKPQGHTKLQIPASTKSYQLPCFEKMHGEIRFTSPVYSLNTS 1886

  Fly  2196 A----VTAHTHLSMA---------ASIE----NEDNFLE------TSVGIQLETDAIPHYGCQVY 2237
            |    |:| ||...|         ||:|    |.|..::      |.|.:. ||..|.|    .|
Zfish  1887 AEFKNVSA-THPQFAGVIKSKGISASLEVLNYNIDYTMQISIPEMTPVSVS-ETLKITH----SY 1945

  Fly  2238 FKKDFSAVDKAIDIRFEVTDNGTLNQLHISTDWHTDPSYIVNANGRIKTTMLPLQMASTSVLVIQ 2302
            ...|.||   ::.:...:|.....:.|.:      |.||....|..:.:....:.:||.:|.|.|
Zfish  1946 LTLDQSA---SLTLNASITKGPDFSSLSL------DTSYKNQVNIPLHSLSSEVTLASKAVAVYQ 2001

  Fly  2303 G-----------------------QNPHLNFDLNLLSQNGQSIA-YGARANKKKDVFNIEVWTPM 2343
            .                       :..|   |.:||...|.|.| ...:.:.......:|:    
Zfish  2002 NNAAVILKVLNTGIGKFTLEDFSDEGTH---DSDLLFTMGLSAAKLRLKGHTDSSALQMEM---- 2059

  Fly  2344 KNFRNISMHGTAI-------------RSPRDPGRYDVSGFLYRNMATYEVTGAVRMTNSLPIDVV 2395
                |:.:...|:             :||          |:.:|:..  .:|.|.:.:   :|| 
Zfish  2060 ----NVDVDADAVALSYLKFNVFAETKSP----------FIKKNLLV--ASGNVSIND---MDV- 2104

  Fly  2396 LRVQPKAGGR-----DGVIELNIHEAG-----PKKIRFSFSAIEDGKMCQMSGG-------YSVS 2443
                 |..|.     |||:.:.:....     |::|...|         |..|.       :.::
Zfish  2105 -----KISGNHETEFDGVVSVVLSNTASVIICPREIAVEF---------QNKGNAKTDLYEFLIT 2155

  Fly  2444 KTNGAMDFSVLVESTEPE-----IARINFY---GNLSPNSEGSLVGDLSLETPWKALGIDTVHLH 2500
            ..:...|::|:|.|...|     :|:||.|   .||:.|:..:.:|..:        |:::    
Zfish  2156 SVDLQNDYTVIVNSDLQEVSTIAVAQINHYKYSHNLTANNNNAEIGVYA--------GVNS---- 2208

  Fly  2501 SDVGFLNKGGHIVG---EYKIGQYIGRGSCLWSWILAEDMQLVLENYLERPNAKPRIVHASAKYQ 2562
              .|.||.....|.   :..:.:|:...|.:|.       .....|.....|||       ..||
Zfish  2209 --FGILNNAVQFVPFVFKKAVVEYLKDESGIWH-------DFTTNNQATDLNAK-------LVYQ 2257

  Fly  2563 NPGQTFTQLQAGGRLSV---------------DSKWNLDVNGSAEYKSVDDFKFRVI-TALPLPV 2611
               :|.|.|.....|:|               .|..||:.|... |.  ||:..|:. ||    .
Zfish  2258 ---KTTTVLGDSDGLAVVVPSLGNLVSEVSSTSSILNLNANAGV-YP--DDYLMRISGTA----T 2312

  Fly  2612 GDRHQLSASYQGNVISQQFNNPDFVLEASYESFEAQNKLLSRISYKNATNNLKGLGHVEWGKIQN 2676
            ....||.|...|               |:..:.|:..||.|.:...|:          :.|...|
Zfish  2313 SAFQQLRAKLYG---------------ATIITTESGLKLASTLFLDNS----------QIGGTHN 2352

  Fly  2677 LSV-VEGDFELLHKQGAQREFSAKIITPKFKNEHTFALTGSYDLEKSGHHNVVGSLDYPASRRIT 2740
            .|| ::.::|::.......:.:..|.:  .:.:|..:......|:...:..:..|.|:|.||...
Zfish  2353 SSVTLQDNYEVVLVSDTIAKINLTIFS--IEADHQLSADTKTHLKALSNLKIKYSFDHPDSRGGG 2415

  Fly  2741 DLD-----------VSVSSLSNMHGIFNSTLP-------TFLNVSWLKTDFNFTTN------NGK 2781
            |.:           ::|.|.|.:  ..|||||       |      |.:|.|.:.|      |.|
Zfish  2416 DAENTLKMNAYLSSITVESTSQV--TTNSTLPDGGALKGT------LDSDANISVNVAGLKSNVK 2472

  Fly  2782 SYRYCRCFWPQDTAYFKLNSNYDSDSSNFNHNLNGNVEIEVPLATRHRADIVYGLQKRRNQDAGN 2846
            :               ..|..||..::..:.::|..|.:|                       ||
Zfish  2473 A---------------SANGYYDYRNNKLSFDMNDQVILE-----------------------GN 2499

  Fly  2847 VKVVYNEKQVLD------GKYKRLEQA-KAPIYKETTDISLENEVKPLGIHFVSTRDASDPAGSQ 2904
            ...::   .:||      .||:|.|.| |...:.:||.|.:...:  ..:.|..|:...|     
Zfish  2500 FNRIH---YLLDIDSNYTHKYRREEVAVKHTAHGKTTIIPMSTFM--AAVDFFLTQPDHD----- 2554

  Fly  2905 DVKH--IEIYELRNTQNFNLTGELHSRATLKAQDFKVVAIH--PNRAVVLSTKYEDVSPEV-VRH 2964
            |.:|  .....:..|..:|  |:::||....:....|.:.:  |:|..:|...:...:|.| |.:
Zfish  2555 DFEHRGEGFGYINKTSLYN--GQIYSRWFNSSTAISVESDNDSPDRKFLLECSFNFTAPSVLVEY 2617

  Fly  2965 HSKL 2968
            .|:|
Zfish  2618 ESEL 2621

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 147/658 (22%)
DUF1943 665..1012 CDD:286281 78/349 (22%)
DUF1081 1029..1122 CDD:283982 21/98 (21%)
VWD 3741..3908 CDD:295339
C8 3951..4014 CDD:285899
apobb.2XP_002665852.3 Vitellogenin_N 23..535 CDD:279663 143/643 (22%)
DUF1943 597..889 CDD:286281 78/348 (22%)
DUF1081 908..1001 CDD:283982 24/123 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.