DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trx-2 and Pdia6

Sequence 1:NP_523526.1 Gene:Trx-2 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_082235.2 Gene:Pdia6 MGIID:1919103 Length:440 Species:Mus musculus

Alignment Length:75 Identity:23/76 (30%)
Similarity:42/76 (55%) Gaps:1/76 (1%)


  Fly    19 SGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTF-VFLK 82
            |..|.:::|:|.|||.|:.::|:..:.:|...|.|.|..|:.|:.:.:..:|.:...||. :|..
Mouse    42 SDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGA 106

  Fly    83 NGVKVEEFAG 92
            |..|.|::.|
Mouse   107 NKNKPEDYQG 116

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 23/76 (30%)
Pdia6NP_082235.2 PDI_a_P5 26..128 CDD:239299 23/76 (30%)
PDI_a_P5 161..266 CDD:239299
P5_C 275..404 CDD:239281
Prevents secretion from ER. {ECO:0000255|PROSITE-ProRule:PRU10138} 437..440
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0526
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.