DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trx-2 and pdia2

Sequence 1:NP_523526.1 Gene:Trx-2 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001307463.1 Gene:pdia2 ZFINID:ZDB-GENE-040426-705 Length:555 Species:Danio rerio

Alignment Length:108 Identity:29/109 (27%)
Similarity:51/109 (47%) Gaps:21/109 (19%)


  Fly    18 ASGKLVVLDFFATWCGPCKMISPKLVELSTQF---ADNVVVLKVDVDECEDIAMEYNISSMPTFV 79
            :..|.::::|:|.|||.|:.:.|...|::.|.   :..|.:.|||..|.:::|.|:::.|.||..
Zfish    71 SENKYLLVEFYAPWCGHCRSLEPIYAEVAGQLKNASSEVRLAKVDAIEEKELASEFSVDSFPTLK 135

  Fly    80 FLKNGVK------------------VEEFAGANAKRLEDVIKA 104
            |.|.|.:                  :|:....:|..|.||..|
Zfish   136 FFKEGNRQNATTFFGKRTLKGIKRWLEKHTAPSATVLNDVKSA 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 28/106 (26%)
pdia2NP_001307463.1 ER_PDI_fam 56..512 CDD:273457 29/109 (27%)
PDI_a_family 65..161 CDD:239259 23/90 (26%)
PDI_b_family 169..268 CDD:239279 5/11 (45%)
PDI_b'_family 280..382 CDD:239280
PDI_a_PDI_a'_C 403..505 CDD:239293
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0526
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.