DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Trx-2 and erp27

Sequence 1:NP_523526.1 Gene:Trx-2 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_017209875.1 Gene:erp27 ID: Length:252 Species:Danio rerio

Alignment Length:56 Identity:15/57 (26%)
Similarity:29/57 (51%) Gaps:3/57 (5%)


  Fly    47 TQFADNVVVL-KVDVDEC--EDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLE 99
            ::|.|.|..: ::.|..|  :::..:|.|||....||.|..:..|....:.||:::
Zfish    56 SEFLDAVKQMQELPVALCSEKEVWAKYGISSDTISVFRKADLHQEHLKLSEAKKVD 111

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 15/57 (26%)
erp27XP_017209875.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0526
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.