DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr30B and CG34461

Sequence 1:NP_609295.1 Gene:Cpr30B FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001097547.1 Gene:CG34461 FlyBaseID:FBgn0250833 Length:138 Species:Drosophila melanogaster

Alignment Length:116 Identity:53/117 (45%)
Similarity:67/117 (57%) Gaps:16/117 (14%)


  Fly    13 LASAVWAIELQAEPDYGPVAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQY 77
            |:.||.|:  .|||...| .|.|.:.:.||||||||||.|.|..|.|:|.|.|::.||..|.|.|
  Fly    35 LSHAVHAV--HAEPVAYP-KYSFNYGIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGSVRTVDY 96

  Fly    78 KADDHNGFEAIVQREPTDIKIPLPEPPKKLLA-AKIL--TPVLPVAPLVHY 125
            .|||||||.|:|.:          ..|.|::| |.:|  .|||..|||:|:
  Fly    97 TADDHNGFNAVVHK----------TAPSKIIAHAPVLHAAPVLAHAPLLHH 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 30/52 (58%)
CG34461NP_001097547.1 Chitin_bind_4 52..104 CDD:278791 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.