DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr30B and Ccp84Ad

Sequence 1:NP_609295.1 Gene:Cpr30B FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_649680.1 Gene:Ccp84Ad FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster

Alignment Length:151 Identity:57/152 (38%)
Similarity:75/152 (49%) Gaps:22/152 (14%)


  Fly    23 QAEPDYGP-VAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFE 86
            :|..:|.| ..|::.:.|.|..:||.|||.|.|..|.|.|.|.|||:|||:|.|||.||..|||.
  Fly    51 KAAEEYDPHPQYKYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFN 115

  Fly    87 AIVQREPTDIKIPLPEPPKKLLAAKILTPVLP-------------VAPLVHYAAPKAIIK----- 133
            |:|.|||. :|.....|..|.:||.:.....|             |||:.||||| |::|     
  Fly   116 AVVNREPL-VKAVAVAPVVKTVAAPVAHYAAPAVAHYAAPAVVKTVAPVAHYAAP-AVVKTVAPV 178

  Fly   134 -QELSAGNYVSVSGPTAQYKY 153
             ...:...|.|.:.|...|.:
  Fly   179 AHYAAPATYTSYAAPAVAYHH 199

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 28/52 (54%)
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:278791 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50321
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.