DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr30B and Cpr76Ba

Sequence 1:NP_609295.1 Gene:Cpr30B FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_649120.1 Gene:Cpr76Ba FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster

Alignment Length:66 Identity:35/67 (52%)
Similarity:45/67 (67%) Gaps:1/67 (1%)


  Fly    25 EPDYGPVAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFEAIV 89
            ||.:.| .|||.:.|.|..|||||.|.|:|..|||:|.|.:.::||..|||:|.||.||||:|.|
  Fly    93 EPKHHP-KYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQATV 156

  Fly    90 Q 90
            :
  Fly   157 K 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 29/52 (56%)
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:278791 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.