DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr30B and Crys

Sequence 1:NP_609295.1 Gene:Cpr30B FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001285854.1 Gene:Crys FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster

Alignment Length:63 Identity:33/64 (52%)
Similarity:41/64 (64%) Gaps:0/64 (0%)


  Fly    33 YEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFEAIVQREPTD 95
            |.|.:.|.|..|||.|.|:|.|..|.|:|.|.||:.||.||||:|.|||.:||.|||.::..|
  Fly    77 YSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVSKQRLD 139

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 28/52 (54%)
CrysNP_001285854.1 Chitin_bind_4 77..129 CDD:278791 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49872
eggNOG 1 0.900 E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.