DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr30B and Cpr23B

Sequence 1:NP_609295.1 Gene:Cpr30B FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_608718.1 Gene:Cpr23B FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster

Alignment Length:104 Identity:42/105 (40%)
Similarity:55/105 (52%) Gaps:14/105 (13%)


  Fly    25 EPD-YGPVAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFEAI 88
            ||: :.|.:|.|.::|||..|||||...|:|....|.|.|.|||.|||:|.|.|.|||.:||.|:
  Fly   148 EPEVFPPASYSFNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTADDVHGFNAV 212

  Fly    89 VQREPTDIKIPLPEPPKKLLAAKILTPVLPVAPLVHYAA 127
            |.|.|..:|             .::.||..||....:.|
  Fly   213 VNRVPYALK-------------AVVVPVAQVAQPTPFVA 238

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 28/52 (54%)
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:278791 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.