DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr30B and CG42367

Sequence 1:NP_609295.1 Gene:Cpr30B FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_723502.2 Gene:CG42367 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster

Alignment Length:91 Identity:43/92 (47%)
Similarity:58/92 (63%) Gaps:5/92 (5%)


  Fly     8 LLCLCLAS--AVWAIELQAEPD---YGPVAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELID 67
            ::||.|::  ||.|..:.:.||   ..|..|||.:||:|.|:||:|.|.|.|:.:.|.|.|.|:|
  Fly     9 VICLILSALVAVQAGIIASHPDELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVD 73

  Fly    68 SDGYRRIVQYKADDHNGFEAIVQREP 93
            .||:||||.|.||...||.|.|:|||
  Fly    74 PDGHRRIVDYTADPLLGFNAQVRREP 99

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 28/52 (54%)
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:278791 26/47 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5112989
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.