DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17855 and cttnbp2nl

Sequence 1:NP_609294.1 Gene:CG17855 FlyBaseID:FBgn0032124 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_002932174.1 Gene:cttnbp2nl XenbaseID:XB-GENE-6042500 Length:634 Species:Xenopus tropicalis

Alignment Length:257 Identity:67/258 (26%)
Similarity:115/258 (45%) Gaps:59/258 (23%)


  Fly     3 KRATSTMQVLYAELAAAKSRS----AELEEENILLRHRLNRASASHSTNAAINVEAKIMVFQLEE 63
            |:..:..:.:.|:||||::|.    .:||||    |.|       |:.:||   :...:.:.||:
 Frog    88 KQCKTMQERMLAQLAAAENRHRKVILDLEEE----RRR-------HAQDAA---DGDDVTYMLEK 138

  Fly    64 ERDRLVETLQKHKKKYNKLHDAYLEKVKRCRALEEMFKRQKTLTGLVMKSSLDQRNAEQRMAMEK 128
            ||:||.:.|:..|.:..||..   |:.:....|||...|.|.|:.::||......|    .|:|:
 Frog   139 ERERLAQQLEFEKSQVKKLEK---EQKRLSSQLEEEKARHKQLSSVLMKECTKANN----RAVEE 196

  Fly   129 RQSAQSDVN-ELNELKAKVEKLQ--------RALDESYDI---IDEMDFELESVELL----EMQN 177
            .|.. .||| :|.:::::|.:|:        |.|.....:   :.|.|.|.|.::..    |.:.
 Frog   197 GQRV-DDVNLKLEKVRSRVSQLEEELSLEKKRGLQIEAQVEKQLSEFDIEREQLKAKLNREENRT 260

  Fly   178 QSLRDELAAFKAKSEEGATSLPASLP----------------NDDDPPPKYEEDYPGQHHKA 223
            ::|::||.:.|...:|..|:...|:|                |.|......:.| |.||.|:
 Frog   261 KTLKEELESLKKTLKELNTTHQVSVPSCKVTSELVSICVSTENADVVSVSCQTD-PFQHEKS 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17855NP_609294.1 Smc <14..>291 CDD:224117 66/247 (27%)
cttnbp2nlXP_002932174.1 CortBP2 5..188 CDD:286770 35/117 (30%)
Utp11 <86..184 CDD:295201 34/113 (30%)
DUF342 <194..291 CDD:302792 23/98 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.