DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gdi and gdi2

Sequence 1:NP_001245953.1 Gene:Gdi FlyBaseID:FBgn0004868 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001005676.1 Gene:gdi2 XenbaseID:XB-GENE-980621 Length:446 Species:Xenopus tropicalis

Alignment Length:448 Identity:301/449 (67%)
Similarity:361/449 (80%) Gaps:7/449 (2%)


  Fly     1 MNEEYDAIVLGTGLKECILSGMLSVSGKKVLHIDRNKYYGGESASITPLEELFQRYGL--EPPGE 63
            ||||||.|||||||.||||||::||:||||||:|||.|||||||||||||:|::|:.:  .|| |
 Frog     1 MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNSYYGGESASITPLEDLYKRFNIPGSPP-E 64

  Fly    64 RFGRGRDWNVDLIPKFLMANGQLVKLLIHTGVTRYLEFKSIEGSYVYKGGKIAKVPVDQKEALAS 128
            ..|||||||||||||||||||||||:|:.|.|||||:||.||||:|||||||.|||..:.|||.|
 Frog    65 CMGRGRDWNVDLIPKFLMANGQLVKMLLFTEVTRYLDFKVIEGSFVYKGGKIYKVPSTEAEALTS 129

  Fly   129 DLMGMFEKRRFRNFLIYVQDFREDDPKTWKDFDPTKANMQGLYDKFGLDKNTQDFTGHALALFRD 193
            .||||||||||:.||.||.:|.|:|.||.:..||.|..|:.:|.||.|.::..|||||||||:|.
 Frog   130 SLMGMFEKRRFKKFLSYVANFDENDSKTLECVDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRT 194

  Fly   194 DEYLNEPAVNTIRRIKLYSDSLARYGKSPYLYPMYGLGELPQGFARLSAIYGGTYMLDKPIDEIV 258
            ||||::|.:.||.||||||:|||||||||||||:|||||||||||||||||||||||:|||:|:|
 Frog   195 DEYLDQPCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEELV 259

  Fly   259 LGEGGKVVGVRSGEEVAKCKQVYCDPSYVPEKVRKRGKVIRCICILDHPVASTKDGLSTQIIIPQ 323
            : |.||:|||:|..|||:|||:.||||||.::|.|.|:|||.||||.||:.:|.|..|.||||||
 Frog   260 M-ENGKIVGVKSEGEVARCKQLICDPSYVSDRVTKVGQVIRVICILSHPIKNTNDANSCQIIIPQ 323

  Fly   324 KQVGRKSDIYVSLVSSTHQVAAKGWFVGMVSTTVETENPEVEIKPGLDLLEPIAQKFVTISDYLE 388
            .||.|||||||.::|..|.|||:|.::.:|||||||.:||.||||.|:|||||.||||:|||...
 Frog   324 NQVNRKSDIYVCMISYAHNVAAQGKYIAIVSTTVETNDPEREIKPVLELLEPIEQKFVSISDMYA 388

  Fly   389 PIDDGSESQIFISESYDATTHFETTCLDVLNIFKRGTGETFDFSKIKHELGD---EEQ 443
            |.|.|::||||||.:||.||||||||.|:.:|:||..|..|||.::|.:..|   |:|
 Frog   389 PTDVGTDSQIFISRTYDPTTHFETTCNDIKDIYKRMMGSEFDFEEMKRKKSDIFGEDQ 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GdiNP_001245953.1 GDI 1..435 CDD:279353 297/436 (68%)
gdi2NP_001005676.1 GDI 1..436 CDD:307232 298/437 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25392694
eggNOG 1 0.900 E1_COG5044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D388394at33208
OrthoFinder 1 1.000 FOG0001017
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.810

Return to query results.
Submit another query.