DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-4 and trn

DIOPT Version :10

Sequence 1:NP_523519.2 Gene:Toll-4 / 34235 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster
Sequence 2:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster


Alignment Length:430 Identity:87/430 - (20%)
Similarity:152/430 - (35%) Gaps:129/430 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 TLGINEVA----CPLKCNCSYNRDKSQLEIDCWQKNLTTIPSLPVPKKGSSALVFQSNLLAELPD 424
            ::|:...|    ||..|.|    |.:.|.:.|.:..|..:|....|  ....||.:||.:..: |
  Fly    18 SIGVEPAAGLANCPPGCQC----DDNTLVVQCGEGQLDVLPIALNP--SIQRLVIKSNKIKTI-D 75

  Fly   425 NSLEGYHNLKSLDVSYNQLTSLSVSQ----LPESLHYLDIRHNKITTLSPQVVEYLYSVNVFNQY 485
            :|::.|..|..||:|.|.|  :::.|    ..:.|..:.:.||||..:|.:....|.:|.|.|..
  Fly    76 SSIQFYAELTFLDLSSNHL--MTIPQRTFAYQKKLQEVHLNHNKIGQISNKTFIGLSAVTVLNLR 138

  Fly   486 GNKWS---------------------------------------IYCDEY--------------- 496
            ||:.|                                       :|.|:.               
  Fly   139 GNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDDNALTTVPDPVIFQAMP 203

  Fly   497 HLQEFFWYKAKLLRIKTSKFQTIMEYIELSSKGSFVENFF------VQNIDQLYLEANEDEIIDA 555
            .|.|.|.....|..|:...||.:.....|..||:.:.|..      :|.:..|.|..|..:.|.:
  Fly   204 SLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQELRILDLSDNRLDRIPS 268

  Fly   556 FGPSDKYFNLKLMEALNHAIWLFSGEFDEIILHHLNSPCPYRCSCCFEWHTGEFLINCRNLSLDI 620
            .|.|    .|..:|.|:    |...:|:.|                   ..|.|:          
  Fly   269 VGLS----KLVRLEQLS----LGQNDFEVI-------------------SEGAFM---------- 296

  Fly   621 YPRLPNSIPYKTTLYLDRNEIRKLTNTESLVVAGHASIHKLHMSQN-LLRELPLHLLP--ENITY 682
                    ..|....|:.|...:|....:...:.:.::..|::|.| :|.|:....|.  ..:.:
  Fly   297 --------GLKQLKRLEVNGALRLKRVMTGAFSDNGNLEYLNLSSNKMLLEVQEGALSGLSQLKH 353

  Fly   683 LDVRNNLLKYLDDGVIAFLEYRENITKIELSGNPWECNCK 722
            :.::.|.|..|.:|:..:    :::..::||.||..|:|:
  Fly   354 VVLKANALTSLAEGLFPW----KDLQTLDLSENPLSCDCR 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-4NP_523519.2 LRR 210..>470 CDD:443914 31/113 (27%)
leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..386 CDD:275380 7/25 (28%)
PRK15370 <381..>482 CDD:185268 28/104 (27%)
leucine-rich repeat 388..408 CDD:275380 4/19 (21%)
leucine-rich repeat 412..432 CDD:275378 7/19 (37%)
LRR <416..591 CDD:443914 51/238 (21%)
leucine-rich repeat 433..454 CDD:275378 7/24 (29%)
leucine-rich repeat 455..478 CDD:275378 7/22 (32%)
leucine-rich repeat 479..490 CDD:275378 5/10 (50%)
leucine-rich repeat 632..657 CDD:275378 3/24 (13%)
leucine-rich repeat 658..679 CDD:275378 6/23 (26%)
leucine-rich repeat 680..706 CDD:275378 4/25 (16%)
PCC 684..>771 CDD:188093 10/39 (26%)
leucine-rich repeat 707..719 CDD:275378 4/11 (36%)
leucine-rich repeat 771..791 CDD:275380
PRK15370 <793..>877 CDD:185268
leucine-rich repeat 793..815 CDD:275378
leucine-rich repeat 816..835 CDD:275378
leucine-rich repeat 836..859 CDD:275378
TIR 974..1110 CDD:214587
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 6/18 (33%)
LRR 82..406 CDD:443914 68/359 (19%)
leucine-rich repeat 84..107 CDD:275380 7/24 (29%)
leucine-rich repeat 108..131 CDD:275380 7/22 (32%)
leucine-rich repeat 132..155 CDD:275380 6/22 (27%)
leucine-rich repeat 156..179 CDD:275380 0/22 (0%)
leucine-rich repeat 180..204 CDD:275380 2/23 (9%)
leucine-rich repeat 205..228 CDD:275380 7/22 (32%)
leucine-rich repeat 229..252 CDD:275380 4/22 (18%)
leucine-rich repeat 253..276 CDD:275380 7/26 (27%)
leucine-rich repeat 277..300 CDD:275380 7/63 (11%)
leucine-rich repeat 301..322 CDD:275380 3/20 (15%)
leucine-rich repeat 326..350 CDD:275380 6/23 (26%)
leucine-rich repeat 351..373 CDD:275380 4/25 (16%)
LRRCT 382..434 CDD:214507 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.