DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-4 and LOC1269216

DIOPT Version :10

Sequence 1:NP_523519.2 Gene:Toll-4 / 34235 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster
Sequence 2:XP_307829.3 Gene:LOC1269216 / 1269216 VectorBaseID:AGAMI1_001475 Length:179 Species:Anopheles gambiae


Alignment Length:145 Identity:59/145 - (40%)
Similarity:100/145 - (68%) Gaps:1/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   972 DKKYDAFLSFTHKDEDLI-EEFVDRLENGRHKFRLCFYLRDWLVGESIPDCINQSVKGSRRIIIL 1035
            :|:||||:|:.||||:.: :|.:.|.|:....|::|:::||::.||.|.:...::|:.|||.||:
Mosquito     2 NKRYDAFISYAHKDEEFVTKELLPRFESEELNFKICWHVRDFMPGEMIANETTKAVEESRRTIII 66

  Fly  1036 MTKNFLKSTWGRLEFRLALHATSRDRCKRLIVVLYPDVEHFDDLDSELRAYMVLNTYLDRNNPNF 1100
            ::.|:|:|.||::||..|...:..|:|.|:|.::|.|:...:.||.:|:||:..|||:..::|.|
Mosquito    67 LSLNYLESVWGQIEFSTAYLQSLADKCNRVIPIIYQDIGDIEQLDPQLQAYLKTNTYIRWDDPWF 131

  Fly  1101 WNKLMYSMPHASHLK 1115
            |.||.|:|||...||
Mosquito   132 WEKLHYAMPHKRRLK 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-4NP_523519.2 LRR 210..>470 CDD:443914
leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..386 CDD:275380
PRK15370 <381..>482 CDD:185268
leucine-rich repeat 388..408 CDD:275380
leucine-rich repeat 412..432 CDD:275378
LRR <416..591 CDD:443914
leucine-rich repeat 433..454 CDD:275378
leucine-rich repeat 455..478 CDD:275378
leucine-rich repeat 479..490 CDD:275378
leucine-rich repeat 632..657 CDD:275378
leucine-rich repeat 658..679 CDD:275378
leucine-rich repeat 680..706 CDD:275378
PCC 684..>771 CDD:188093
leucine-rich repeat 707..719 CDD:275378
leucine-rich repeat 771..791 CDD:275380
PRK15370 <793..>877 CDD:185268
leucine-rich repeat 793..815 CDD:275378
leucine-rich repeat 816..835 CDD:275378
leucine-rich repeat 836..859 CDD:275378
TIR 974..1110 CDD:214587 54/136 (40%)
LOC1269216XP_307829.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.