DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Igsf9

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001139272.1 Gene:Igsf9 MGIID:2135283 Length:1179 Species:Mus musculus

Alignment Length:499 Identity:110/500 (22%)
Similarity:196/500 (39%) Gaps:108/500 (22%)


  Fly   106 LNIVVEE-------PEFTEYIENVTVPAGRNVKLGCSVKNLGSYK----VAWMHFEQSAILTVHN 159
            |::::.:       ||    :.:|...||.:..|||.:.....:.    :.|:.|  ..:|.:..
Mouse    10 LSLIISQGADGRRKPE----VVSVVGRAGESAVLGCDLLPPAGHPPLHVIEWLRF--GFLLPIFI 68

  Fly   160 HVITRNPRISVTHDKHDRHRTW-YLHINNVHEEDRGRYMCQINTVT--------AKTQFGYLNVV 215
            .....:|||...:....|.:|. .|.|..:..||:|.|.|::..:.        |...:.:|.|.
Mouse    69 QFGLYSPRIDPDYVGRVRLQTGASLQIEGLRVEDQGWYECRVLFLDQHSPEQDFANGSWVHLTVN 133

  Fly   216 VPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWK-RDDNSRIAINKNHIVNEWEGDTLEI 279
            .||...:: ....:.|:|...::|||.|.|||:|.:.|| |..:    :.|.....:.:..||.|
Mouse   134 SPPQFQET-PPLVLEVKELEAVTLRCVARGSPQPYVTWKFRGQD----LGKGQGQVQVQNGTLWI 193

  Fly   280 TRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSL 344
            .|:.|...|.|.|.||:. ..:::...::.|..||::::|..........:|::.|..||:|.:|
Mouse   194 RRVERGSAGDYTCQASSS-EGSITHATQLLVLGPPVIVVPPSNSTVNSSQDVSLACRAEAYPANL 257

  Fly   345 NY-WTRGEGPIIHDSH-----KYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKN----PR 399
            .| |.:....:.|.|.     :..|:.::.|.|           ....|.|.|.||..|    |.
Mouse   258 TYSWFQDGVNVFHISRLQSRVRILVDGSLWLQA-----------TQPDDAGHYTCVPSNGFLHPP 311

  Fly   400 GETDGIIRLY-----VSYPPTTASSG---------------IYSTDTHWGENG----INNNYAYG 440
            ..:..:..||     |..|.|...:|               ::.|   |.::|    ::....:.
Mouse   312 SASAYLTVLYPAQVTVMPPETPLPTGMRGVIRCPVRANPPLLFVT---WTKDGQALQLDKFPGWS 373

  Fly   441 -GPDSTRSIYAQDKN-------TRYQ-------SNLNEIGLSEQKSFLDKTQNPLLANGNANEAD 490
             ||:.:..|...::|       |.|.       |.:.::.|....:|:|:.:....     .|..
Mouse   374 LGPEGSLIIALGNENALGEYSCTPYNSLGTAGPSPVTQVLLKAPPAFIDQPKEEYF-----QEVG 433

  Fly   491 AE---SNGARGHNPSMAIAWLFVVIATLLLTIRSAVGSSHSLSL 531
            .|   ...||| :|...::|..|...   |..::.|.|::||.|
Mouse   434 RELLIPCSARG-DPPPIVSWAKVGRG---LQGQAQVDSNNSLVL 473

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 24/109 (22%)
Ig 130..200 CDD:143165 18/75 (24%)
I-set 226..310 CDD:254352 24/85 (28%)
IGc2 233..298 CDD:197706 23/66 (35%)
Ig 313..410 CDD:299845 25/112 (22%)
IG_like 325..410 CDD:214653 22/100 (22%)
Igsf9NP_001139272.1 Ig 24..132 CDD:299845 25/114 (22%)
IG_like 28..110 CDD:214653 21/84 (25%)
I-set 136..223 CDD:254352 25/93 (27%)
Ig 154..220 CDD:143165 22/71 (31%)
Ig_3 226..305 CDD:290638 21/90 (23%)
IG_like 233..319 CDD:214653 20/97 (21%)
Ig 341..404 CDD:299845 9/66 (14%)
IG_like 431..503 CDD:214653 14/48 (29%)
Ig 440..503 CDD:299845 12/39 (31%)
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding 1177..1179
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.