DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and PAPLN

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001352835.1 Gene:PAPLN HGNCID:19262 Length:1278 Species:Homo sapiens

Alignment Length:445 Identity:96/446 (22%)
Similarity:140/446 (31%) Gaps:154/446 (35%)


  Fly    38 GGGVGTAQGKHPSGSKTVAT---------GV-----VPNFGGAAGNGAGGGGPVAGSGTGSTVVG 88
            |||...|..:.||..:|.|.         |:     .|..|.|....|.|..| .|...||...|
Human   827 GGGSSPAGEQEPSQHRTGAAVQRKPWPSGGLWRQDQQPGPGEAPHTQAFGEWP-WGQELGSRAPG 890

  Fly    89 SNGVIVAGGGANVP-------TSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAW 146
                  .||.|..|       :..:::...||..      |....|:.|:|.||.......:.||
Human   891 ------LGGDAGSPAPPFHSSSYRISLAGVEPSL------VQAALGQLVRLSCSDDTAPESQAAW 943

  Fly   147 MHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWY---LHINNVHEEDRGRYMC---------- 198
            ....|..                    ..||||..:   |.|:.:..||.|.|.|          
Human   944 QKDGQPI--------------------SSDRHRLQFDGSLIIHPLQAEDAGTYSCGSTRPGRDSQ 988

  Fly   199 --QINTV-------------------TAKTQFGYLNVVVP---------------------PNID 221
              |:..:                   .....||......|                     |.:.
Human   989 KIQLRIIGGDMAVLSEAELSRFPQPRDPAQDFGQAGAAGPLGAIPSSHPQPANRLRLDQNQPRVV 1053

  Fly   222 DSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLD 286
            |:        ..|..|.:.|||.|.|.|.|:|:| |...::..::.:..:   .:|.|:|::..|
Human  1054 DA--------SPGQRIRMTCRAEGFPPPAIEWQR-DGQPVSSPRHQLQPD---GSLVISRVAVED 1106

  Fly   287 MGAYLCIASNG-------VPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSL 344
            .|.|.|:|.||       |...|...:.:| ..||.:.:       |||....:.|.......::
Human  1107 GGFYTCVAFNGQDRDQRWVQLRVLGELTIS-GLPPTVTV-------PEGDTARLLCVVAGESVNI 1163

  Fly   345 NYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMK----LTIINVSSGDDGIYKCVA 395
            . |:|...|:..|.|             :.|..    |.|.|:.:.|:|.|.|.|
Human  1164 R-WSRNGLPVQADGH-------------RVHQSPDGTLLIYNLRARDEGSYTCSA 1204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 23/130 (18%)
Ig 130..200 CDD:143165 19/85 (22%)
I-set 226..310 CDD:254352 25/91 (27%)
IGc2 233..298 CDD:197706 22/72 (31%)
Ig 313..410 CDD:299845 20/88 (23%)
IG_like 325..410 CDD:214653 18/76 (24%)
PAPLNNP_001352835.1 TSP1 29..80 CDD:214559
ADAM_spacer1 183..298 CDD:310520
TSP1 308..361 CDD:214559
TSP1 369..424 CDD:214559
TSP1 424..481 CDD:214559
TSP1 488..539 CDD:214559
Kunitz_BPTI 753..805 CDD:278443
Papilin_u7 814..905 CDD:318767 23/85 (27%)
Ig 914..>978 CDD:325142 21/90 (23%)
I-set 1049..1119 CDD:254352 24/82 (29%)
IG 1139..1219 CDD:214652 20/88 (23%)
PLAC 1235..1267 CDD:312271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.