DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Chl1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_006225061.1 Gene:Chl1 RGDID:620122 Length:1224 Species:Rattus norvegicus

Alignment Length:528 Identity:102/529 (19%)
Similarity:158/529 (30%) Gaps:203/529 (38%)


  Fly   123 TVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINN 187
            ||..|..:.|.|..:.|.:.::.|            :.:.:..|:...|.:.|::    .|.|.|
  Rat   266 TVLKGDTLLLECFAEGLPTPQIEW------------SKLGSELPKGRATIEIHEK----TLKIEN 314

  Fly   188 VHEEDRGRYMCQINTVTAKTQFGYLNVVV--PPNIDDSLSSSDVIVREGANISLRCRASGSPRPI 250
            |..:|||.|.|..|.:..|....: :|:|  ||.......|:  :...|:|..|.|.|.|.|:|.
  Rat   315 VSYQDRGNYRCTANNLLGKASHDF-HVIVE
EPPRWKKKPQSA--VYSTGSNGILLCEAEGEPQPT 376

  Fly   251 IKWKRD-----------------DNSRIAINKNHIV----------------------------- 269
            |||:.:                 :.|...:..||..                             
  Rat   377 IKWRVNGLPIENHPFPGDVMFPREISFTNLQPNHTAVYQCEASNIHGTILANANIDVVDVVPLIQ 441

  Fly   270 --NE--------------------------W-----------------EGDTLEITRISRLDMGA 289
              ||                          |                 |..||||.|.:..|.|:
  Rat   442 TKNEENYETVVGYSAFLHCEYFASPKATVVWEVADETHPLEGGRYHTHENGTLEIERTTEEDAGS 506

  Fly   290 YLCIASNGVPPTVSKRIKVSVD---------FPPMLLIPHQLVGAPEGFNVTIECFTEA------ 339
            |.|...|.:...|   |..::|         ||....||...|         :|.:.|:      
  Rat   507 YSCWVDNTMGKAV---ITANLDIRNATKLRVFPKNPRIPKSHV---------LELYCESQCDSHL 559

  Fly   340 -HPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETD 403
             |...|: |::       |...:::..|...........|||.|:|..|.|||.|.|:.....|.
  Rat   560 KHSLKLS-WSK-------DGEAFEMNGTEDGRIVIDGANLTISNISGEDQGIYSCSAQTALDSTS 616

  Fly   404 GIIRLYVSYPPTTASSGIYSTDTHWGENGINNNYAYGGPDSTRSIYAQDKNTR-----------Y 457
            ...::.|                            .|.||..|::...::..|           :
  Rat   617 EKTQVTV----------------------------LGVPDPPRNLLLSERQNRSVRLSWEAGDDH 653

  Fly   458 QSNLNEIGLSEQKSFLDKTQNPLLANGNANEAD--AESNGARGHNPSMAIAWLFVVIATLLLTIR 520
            .|.::|..:..:              ||..|..  .|....||....:.:.....|.....:|..
  Rat   654 NSKISEYIVEFE--------------GNREEPGKWEELTRVRGEETDVVLPLAPYVRYQFRVTAV 704

  Fly   521 SAVGSSHS 528
            :.||.|||
  Rat   705 NEVGKSHS 712

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/93 (24%)
Ig 130..200 CDD:143165 16/70 (23%)
I-set 226..310 CDD:254352 31/175 (18%)
IGc2 233..298 CDD:197706 28/156 (18%)
Ig 313..410 CDD:299845 23/104 (22%)
IG_like 325..410 CDD:214653 19/92 (21%)
Chl1XP_006225061.1 Ig 54..125 CDD:299845
Ig2_L1-CAM_like 128..222 CDD:143253
IG_like 138..223 CDD:214653
IG_like 263..342 CDD:214653 22/93 (24%)
Ig 273..343 CDD:299845 20/87 (23%)
IG_like 352..433 CDD:214653 15/83 (18%)
Ig4_L1-NrCAM_like 360..434 CDD:143179 14/74 (19%)
IG_like 446..524 CDD:214653 14/81 (17%)
Ig 460..526 CDD:299845 15/69 (22%)
IG_like 547..623 CDD:214653 19/84 (23%)
Ig 554..627 CDD:299845 19/109 (17%)
FN3 627..716 CDD:238020 19/101 (19%)
fn3 730..811 CDD:278470
FN3 832..926 CDD:238020
FN3 931..1026 CDD:238020
Bravo_FIGEY 1120..1205 CDD:290593
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.