DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and dpr21

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster

Alignment Length:253 Identity:71/254 (28%)
Similarity:107/254 (42%) Gaps:43/254 (17%)


  Fly   100 NVPTSNLNIVVEE-----------PEF-TEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQS 152
            ||..::|.::.|.           |.| |...:|||...|....|.|.:||||:..|:|:.....
  Fly    27 NVTVTDLYLISENIVPMKRVLDRGPYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDL 91

  Fly   153 AILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNV--V 215
            .:|||.....|.:.|.:..::|  :...|.|.|......|.|.|.||::|.   ...||..|  |
  Fly    92 HLLTVSESTYTSDQRFTSIYNK--QTGDWSLQIKFPQLRDSGIYECQVSTT---PPVGYTMVFSV 151

  Fly   216 VPPNIDDSLSSSDVIVREGANISLRCRASGSPRP--IIKWKRD------DNSRIAINKNHIVNEW 272
            |.| |...|...::.:..|:.::|.|.....|.|  .::|..:      |:.|..::   ::.| 
  Fly   152 VEP-ITSILGGPEIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGGVS---VITE- 211

  Fly   273 EGDT----LEITRISRLDMGAYLCIASNGVPPTVSKRIKVSV---DFPPMLLIPHQLV 323
            :||.    |.|.|.|..|.|.|.|:.||    ..||.:.|.:   |.|..:...|.||
  Fly   212 KGDITTSYLLIQRASIADSGQYTCLPSN----ANSKSVNVHILKGDHPAAVQKSHLLV 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 31/98 (32%)
Ig 130..200 CDD:143165 22/70 (31%)
I-set 226..310 CDD:254352 24/96 (25%)
IGc2 233..298 CDD:197706 21/77 (27%)
Ig 313..410 CDD:299845 4/12 (33%)
IG_like 325..410 CDD:214653
dpr21NP_001163838.2 Ig 71..149 CDD:299845 26/83 (31%)
IG_like 71..140 CDD:214653 23/71 (32%)
IG_like 162..249 CDD:214653 24/95 (25%)
IGc2 169..242 CDD:197706 21/81 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.