DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and KIRREL3

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_011541328.1 Gene:KIRREL3 HGNCID:23204 Length:809 Species:Homo sapiens

Alignment Length:461 Identity:97/462 (21%)
Similarity:151/462 (33%) Gaps:153/462 (33%)


  Fly   115 FTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWM-------------HFEQSAILTVHNHVITRNP 166
            |::..::..|.:|:.|.|.|::.....: |.|:             .:.|  .|.|.||      
Human    56 FSQQPQDQVVVSGQPVTLLCAIPEYDGF-VLWIKDGLALGVGRDLSSYPQ--YLVVGNH------ 111

  Fly   167 RISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIV 231
             :|..|         :|.|.....:|...|.||......:::...|.|:|||:....|....:.:
Human   112 -LSGEH---------HLKILRAELQDDAVYECQAIQAAIRSRPARLTVLVPPDDPVILGGPVISL 166

  Fly   232 REGANISLRCRA-SGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITR---------ISRLD 286
            |.|..::|.|.| :..|...|.|.|         |..::|   |.|...|.         :|.|.
Human   167 RAGDPLNLTCHADNAKPAASIIWLR---------KGEVIN---GATYSKTLLRDGKRESIVSTLF 219

  Fly   287 MG--------AYLCIASN-GVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPT 342
            :.        :.:|.|:| .:|......:.:.:..||::.:..:.....|...||..|..:|:|.
Human   220 ISPGDVENGQSIVCRATNKAIPGGKETSVTIDIQHPPLVNLSVEPQPVLEDNVVTFHCSAKANPA 284

  Fly   343 SLNY-WTRGEGPIIHD---------------SHKYKVEATVGL--------------PAYKTH-- 375
            ...| |.: .|.||.:               |.....|.|..|              |...|.  
Human   285 VTQYRWAK-RGQIIKEASGEVYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTTEPQ 348

  Fly   376 --------------------------MK------------LTIINVSSGDDGIYKCVAKNPR--- 399
                                      ||            ||:.:|...|.|.|.|.|..||   
Human   349 SLLVDLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGA 413

  Fly   400 GETDGIIRLYVSYPPTTASSGIYSTDTH---WGENGINNNYAYGGPDSTRSIYAQDKNTRYQSNL 461
            ||.:  :.|.|:.||.     |.||.|.   .||.|....:....|...|..::      ::.|:
Human   414 GERE--VTLTVNGPPI-----ISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWS------WKENV 465

  Fly   462 NEIGLS 467
            .|.|.|
Human   466 LESGTS 471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/109 (20%)
Ig 130..200 CDD:143165 18/83 (22%)
I-set 226..310 CDD:254352 20/103 (19%)
IGc2 233..298 CDD:197706 18/84 (21%)
Ig 313..410 CDD:299845 34/170 (20%)
IG_like 325..410 CDD:214653 32/158 (20%)
KIRREL3XP_011541328.1 Ig 58..149 CDD:299845 21/110 (19%)
IG_like 60..149 CDD:214653 21/108 (19%)
I-set 156..249 CDD:254352 21/105 (20%)
Ig2_KIRREL3-like 171..252 CDD:143236 18/93 (19%)
Ig_2 260..337 CDD:290606 15/78 (19%)
I-set 341..422 CDD:254352 17/83 (20%)
IGc2 355..406 CDD:197706 9/51 (18%)
Ig5_KIRREL3 424..521 CDD:143306 15/60 (25%)
IG_like 432..521 CDD:214653 10/47 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.