| Sequence 1: | NP_723441.2 | Gene: | DIP-zeta / 34231 | FlyBaseID: | FBgn0051708 | Length: | 532 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_954649.3 | Gene: | KIRREL2 / 84063 | HGNCID: | 18816 | Length: | 708 | Species: | Homo sapiens | 
| Alignment Length: | 336 | Identity: | 80/336 - (23%) | 
|---|---|---|---|
| Similarity: | 126/336 - (37%) | Gaps: | 70/336 - (20%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   113 PEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAW--MHFEQSAILTVHNHVITRNPRI----SVT 171 
  Fly   172 HDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGAN 236 
  Fly   237 ISLRCRASGS--PRPIIKWKRD----DNSRIAINKNHIVNEWEG------DTLEITRISRLDMGA 289 
  Fly   290 YLCIA-SNGVPPTVSKRIKVSVDFPPMLLI---PHQLVGAPEGFNVTIECFTEAHPTSLNY-WTR 349 
  Fly   350 GEGPI----------------IHDSHKYKVEATVGLPAYKTHMKLTI----------INVSSGDD 388 
  Fly   389 GIYKCVAK-NP 398 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| DIP-zeta | NP_723441.2 | IG_like | 120..216 | CDD:214653 | 24/101 (24%) | 
| Ig | 130..200 | CDD:143165 | 18/75 (24%) | ||
| I-set | 226..310 | CDD:254352 | 25/96 (26%) | ||
| IGc2 | 233..298 | CDD:197706 | 22/77 (29%) | ||
| Ig | 313..410 | CDD:299845 | 24/117 (21%) | ||
| IG_like | 325..410 | CDD:214653 | 20/102 (20%) | ||
| KIRREL2 | NP_954649.3 | IG_like | 30..119 | CDD:214653 | 23/100 (23%) | 
| IGc2 | 38..106 | CDD:197706 | 20/79 (25%) | ||
| I-set | 126..224 | CDD:254352 | 27/102 (26%) | ||
| Ig2_KIRREL3-like | 141..223 | CDD:143236 | 23/86 (27%) | ||
| Cell attachment site. /evidence=ECO:0000255 | 149..151 | 0/1 (0%) | |||
| Ig | 231..306 | CDD:299845 | 16/77 (21%) | ||
| IG_like | 234..308 | CDD:214653 | 16/76 (21%) | ||
| Ig | 312..395 | CDD:299845 | 6/28 (21%) | ||
| I-set | 317..395 | CDD:254352 | 6/23 (26%) | ||
| Ig | 397..501 | CDD:299845 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 545..601 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||