DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and KIRREL2

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_954649.3 Gene:KIRREL2 HGNCID:18816 Length:708 Species:Homo sapiens

Alignment Length:336 Identity:80/337 (24%)
Similarity:126/337 (37%) Gaps:70/337 (21%)


  Fly   113 PEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAW--MHFEQSAILTVHNHVITRNPRI----SVT 171
            |.|.:..|::.|..|...:|.|:   ||:|   |  :.:.:|.:.......:....|.    :..
Human    24 PHFLQQPEDLVVLLGEEARLPCA---LGAY---WGLVQWTKSGLALGGQRDLPGWSRYWISGNAA 82

  Fly   172 HDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGAN 236
            :.:||      |||..|..||...|.||......:::...|:|:|||.....|....|.:..|..
Human    83 NGQHD------LHIRPVELEDEASYECQATQAGLRSRPAQLHVLVPPEAPQVLGGPSVSLVAGVP 141

  Fly   237 ISLRCRASGS--PRPIIKWKRD----DNSRIAINKNHIVNEWEG------DTLEITRISRLDMGA 289
            .:|.||:.|.  |.|.:.|.||    |.:..     |.....||      .||.:|..|..|...
Human   142 ANLTCRSRGDARPTPELLWFRDGVLLDGATF-----HQTLLKEGTPGSVESTLTLTPFSHDDGAT 201

  Fly   290 YLCIA-SNGVPPTVSKRIKVSVDFPPMLLI---PHQLVGAPEGFNVTIECFTEAHPTSLNY-WTR 349
            ::|.| |..:|......|.:|:.:||.:.:   ||.:   .||..|...|...|.|....| |.:
Human   202 FVCRARSQALPTGRDTAITLSLQYPPEVTLSASPHTV---QEGEKVIFLCQATAQPPVTGYRWAK 263

  Fly   350 GEGPI----------------IHDSHKYKVEATVGLPAYKTHMKLTI----------INVSSGDD 388
            |..|:                :.:....:|...||.....|.:.:..          ::|..|:|
Human   264 GGSPVLGARGPRLEVVADASFLTEPVSCEVSNAVGSANRSTALDVLFGPILQAKPEPVSVDVGED 328

  Fly   389 GIYKCVAK-NP 398
            ..:.|..: ||
Human   329 ASFSCAWRGNP 339

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 24/102 (24%)
Ig 130..200 CDD:143165 19/76 (25%)
I-set 226..310 CDD:254352 26/97 (27%)
IGc2 233..298 CDD:197706 22/78 (28%)
Ig 313..410 CDD:299845 24/118 (20%)
IG_like 325..410 CDD:214653 20/103 (19%)
KIRREL2NP_954649.3 IG_like 30..119 CDD:214653 23/101 (23%)
IGc2 38..106 CDD:197706 20/80 (25%)
I-set 126..224 CDD:254352 27/103 (26%)
Ig2_KIRREL3-like 141..223 CDD:143236 24/87 (28%)
Cell attachment site. {ECO:0000255} 149..151 1/2 (50%)
Ig 231..306 CDD:299845 16/78 (21%)
IG_like 234..308 CDD:214653 16/77 (21%)
Ig 312..395 CDD:299845 6/29 (21%)
I-set 317..395 CDD:254352 6/24 (25%)
Ig 397..501 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.