DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and si:ch211-57n23.4

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_009292645.2 Gene:si:ch211-57n23.4 ZFINID:ZDB-GENE-140106-153 Length:722 Species:Danio rerio

Alignment Length:493 Identity:110/494 (22%)
Similarity:181/494 (37%) Gaps:109/494 (22%)


  Fly    74 GGPVAGSGTGSTV-VGSNGVIV--------------AGGGANVPTSNLNIVVEE---------PE 114
            |.|:. :|.||.| :.|||.::              ||.......::..::|..         |:
Zfish    60 GAPLL-AGIGSRVKILSNGTLLIRSFQKRRDGDATDAGEYYCAAQNHYGMLVSRKARVQLASLPK 123

  Fly   115 FTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHR 179
            |..:.|:::|..|...:..|.|..:....:.|          ..:||:     :..:.|::....
Zfish   124 FHTHPESMSVDDGGVARFQCQVNGIPEASITW----------EKDHVV-----LGTSDDRYTLLP 173

  Fly   180 TWYLHINNVHEEDRGRYMCQINTVTAKTQF---GYLNVV--VP-----PNIDDSLSSSDVIVREG 234
            ...|.|..|.:.|.|.|.|..:.: |.|::   .:|||.  ||     |.|.....:..:.|.:.
Zfish   174 MGILQITGVKKADAGIYRCVASNI-ANTRYSHEAHLNVTGGVPRTYKEPVILSGPQNLTITVHQT 237

  Fly   235 ANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVP 299
            |  .|.|.|:|:||||:.|.|.|...|.:....::..   ..|.|:.:|....|.|:|.|:.  |
Zfish   238 A--ILECIATGNPRPIVSWSRLDGRSIGVEGIQVLGT---GNLMISDVSLQHSGVYVCAANR--P 295

  Fly   300 PTVSKRI---KVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKY 361
            .|..:|.   ::.|..||..:...|.|..|.|.:....|..:..|.....|.: .|.|:......
Zfish   296 GTRMRRTALGRLVVQAPPEFIQWPQSVSKPAGGSAVFTCVAQGVPEPHIIWLK-NGKILTPGDNV 359

  Fly   362 KVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVS--------------- 411
            |:.        ..:..|.:..::|.|:.||:|:|:|..|......||.||               
Zfish   360 KLT--------NNNSTLAVTRITSEDEAIYQCIAENTAGTNQASARLAVSLAKELPDSPQGLKAT 416

  Fly   412 ------------YPPTTASSGIYSTDTHWGENGINNNYAYGGPDSTRSIYAQDKNTRYQSNLNEI 464
                        .||...:.||.....|..:        ||..:|.....|..|.| :|.:|..:
Zfish   417 ALSKTSLQLSWTQPPAEVTDGIIGYVLHIRK--------YGESESKELQEAVSKTT-FQHDLTNL 472

  Fly   465 GLSEQKSFLDKTQNPLLANGNANEADAESNGARGHNPS 502
            ..:...|...|..:||   |.:.::....:...|..||
Zfish   473 EPATTYSIYLKAYSPL---GASQQSSTVVSTTLGGVPS 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 21/101 (21%)
Ig 130..200 CDD:143165 13/70 (19%)
I-set 226..310 CDD:254352 24/87 (28%)
IGc2 233..298 CDD:197706 20/65 (31%)
Ig 313..410 CDD:299845 23/97 (24%)
IG_like 325..410 CDD:214653 19/85 (22%)
si:ch211-57n23.4XP_009292645.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.