DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and opcml

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001072487.1 Gene:opcml XenbaseID:XB-GENE-5831850 Length:346 Species:Xenopus tropicalis

Alignment Length:353 Identity:109/354 (31%)
Similarity:165/354 (47%) Gaps:47/354 (13%)


  Fly    81 GTGSTVVGS-NGVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKV 144
            |...||:.| .||.|..|.|..|.:              ::||||..|.:..|.|:|.|..: :|
 Frog    19 GAALTVLLSITGVPVRSGDAGFPKA--------------MDNVTVRQGDSAILRCTVDNRVT-RV 68

  Fly   145 AWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVT-AKTQ 208
            ||::  :|.||...|...:.:||:.:..:...::.   :.|.||...|.|.|.|.:.|.. .||.
 Frog    69 AWLN--RSTILYTGNDKWSIDPRVVLLANTKSQYS---IEIQNVDIYDEGPYTCSVQTDNHPKTS 128

  Fly   209 FGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNH-IVNEW 272
            ..:|.|.|.|.|.:  .|||:.|.||:.::|||.|:|.|.|.:.|      |....|:| .|:  
 Frog   129 RVHLIVQVAPQILN--ISSDITVNEGSTVALRCLATGRPEPAVTW------RHFTGKSHRFVS-- 183

  Fly   273 EGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFT 337
            :.:.||||.|:|...|.|.|.|:|.|.....::::|:|::||.:..... .||..|....:.|..
 Frog   184 DDEYLEITGITRDQSGQYECSAANDVSAPDIRKVRVTVNYPPYISDTRN-TGASLGQKGILRCSA 247

  Fly   338 EAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMK-LTIINVSSGDDGIYKCVAKNPRGE 401
            .|.|.:...|.|.|..:.:.....::|       .|.||. ||..|||..|.|.|.|||.|..|.
 Frog   248 SAVPLAEFQWYREETRLANGLDGVRIE-------NKDHMSILTFFNVSEKDYGNYTCVASNKLGN 305

  Fly   402 TDGIIRLY-----VSYPPTTASSGIYST 424
            ::..:.||     :....::||:.|.:|
 Frog   306 SNASVILYAGPGAIHNRSSSASAAIAAT 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/97 (31%)
Ig 130..200 CDD:143165 20/70 (29%)
I-set 226..310 CDD:254352 31/85 (36%)
IGc2 233..298 CDD:197706 25/66 (38%)
Ig 313..410 CDD:299845 30/103 (29%)
IG_like 325..410 CDD:214653 27/91 (30%)
opcmlNP_001072487.1 Ig 46..134 CDD:325142 29/94 (31%)
Ig_3 138..207 CDD:316449 30/79 (38%)
ig 228..312 CDD:278476 26/92 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.