DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and zgc:152904

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001070212.1 Gene:zgc:152904 ZFINID:ZDB-GENE-060929-856 Length:809 Species:Danio rerio

Alignment Length:510 Identity:119/511 (23%)
Similarity:187/511 (37%) Gaps:86/511 (17%)


  Fly    74 GGPVA---GSGTGSTVVGSNGVIVAGGGANVPTSNLNIVVE---------------EPEFTEYIE 120
            |.||:   .|..|..::.:..|||...|.....:..|.::|               ..|.|..:|
Zfish    15 GEPVSINWFSPQGERIISNERVIVHTEGVRSRLTIYNAIIENAGIYRCQAADAKGQSQEATVVLE 79

  Fly   121 --------NVTVP----AGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNP--RISVT 171
                    .|..|    .|.:.::.|.|.:.....|:|.:         .|..||..|  |..|.
Zfish    80 IYQKLTFREVKTPQEFRQGDDAEVVCDVISSPVPAVSWFY---------KNREITSEPNSRFQVL 135

  Fly   172 HDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLS----SSDVIVR 232
            ...:       |.|..|.:.|.|.|.|:.. |.|:.:..:.::||..|:...||    |.:....
Zfish   136 PTNN-------LQILKVGKADEGAYRCEAR-VEARGEIDFRDIVVQVNVPPVLSVPQQSFNATAD 192

  Fly   233 EGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEG--DTLEITRISRLDMGAYLCIAS 295
            ...:::..|..||||.|.:.|....:: |..::.:::|...|  .||.:..|.:.|.|.|:|.||
Zfish   193 YQESVTFTCVTSGSPDPQVTWYWKGHA-IEHSEQYVLNTMNGGKSTLTVKNIKQTDGGPYMCRAS 256

  Fly   296 NGVPPTVSKR-IKVSVDFPPMLLIPH--QL--VGAPEGFNVTIECFTEAHPTSLNYWTR-GEGPI 354
            |....:.|:. :||.|.       ||  ||  |.|.||....|.|..|..|.....|.| .:|..
Zfish   257 NKAGSSESQLFLKVFVQ-------PHITQLRNVTAVEGSAAMISCTAEGEPLPEISWRRASDGHS 314

  Fly   355 IHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPP--TTA 417
            ..|..|.| :..|.:........|||..|...|.|.:.|.|.:..|.....:.|.:.|.|  .|.
Zfish   315 FTDGEKSK-DGRVEVRGRHGKSMLTISGVQLSDWGRFDCEALSRIGGHQKSMFLDIEYAPKFQTN 378

  Fly   418 SSGIYSTDTHWGENGINNNYAYGGPDSTRSIYAQDKNTRYQSNLNEIGL--SEQKSFLDKTQNPL 480
            .|..||    |..|.:|.:.......:...::.:::.|......:.|.:  ::.:|.|:.|....
Zfish   379 QSIFYS----WEGNPVNISCEVKSNPAATMLWRRERFTISSQGTSNIRIHSTDGRSLLEVTPVSD 439

  Fly   481 LANGNANEADAESNGARGHN--------PSMAIAWLFVVIATLLLTIRSAVGSSH 527
            ...|..|.....:.|||...        ||...:.....::..:.|:......||
Zfish   440 RDFGRYNCTARNNIGARYQEFILAQADVPSSPYSVRMTAVSQRMATVSFMKPDSH 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 24/110 (22%)
Ig 130..200 CDD:143165 17/72 (24%)
I-set 226..310 CDD:254352 24/87 (28%)
IGc2 233..298 CDD:197706 20/67 (30%)
Ig 313..410 CDD:299845 29/102 (28%)
IG_like 325..410 CDD:214653 24/86 (28%)
zgc:152904NP_001070212.1 Ig 1..81 CDD:299845 14/66 (21%)
IG_like 2..80 CDD:214653 14/65 (22%)
IGc2 97..158 CDD:197706 18/77 (23%)
Ig 177..273 CDD:299845 27/97 (28%)
I-set 184..270 CDD:254352 23/87 (26%)
Ig 272..369 CDD:299845 30/105 (29%)
I-set 274..367 CDD:254352 28/94 (30%)
IG_like 385..462 CDD:214653 13/77 (17%)
IGc2 386..454 CDD:197706 9/68 (13%)
FN3 468..561 CDD:238020 5/28 (18%)
fn3 <591..650 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.