DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and USH2A

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_996816.2 Gene:USH2A HGNCID:12601 Length:5202 Species:Homo sapiens

Alignment Length:422 Identity:84/423 (20%)
Similarity:148/423 (35%) Gaps:118/423 (28%)


  Fly   119 IENVTVPAGRNVKLGCSVKNLGSYK--VAW-MHFEQSAILTVHNHVIT----------RNPRISV 170
            :||.|:.|.....:...||..||.|  |.| ..|..:.:|| |:.:.|          ....::|
Human  2320 VENRTLEAPPEGTVNVFVKTQGSRKAHVRWEAPFRPNGLLT-HSVLFTGIFYVDPVGNNYTLLNV 2383

  Fly   171 THDKHDRHRT--WYLHINNVHEEDRGRYMCQIN-----------TVTAKTQFGYLNVVVPPNIDD 222
            |...:....|  |.|....|...:   |..|:|           .:|.....|..:.|:||.:..
Human  2384 TKVMYSGEETNLWVLIDGLVPFTN---YTVQVNISNSQGSLITDPITIAMPPGAPDGVLPPRLSS 2445

  Fly   223 SLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDN--------SRIAINKNHIVNEWEGDTLEI 279
            :..:|..:|   .:...|..|.||||..::.:..|:        |..:.:.::.|::.:..|..:
Human  2446 ATPTSLQVV---WSTPARNNAPGSPRYQLQMRSGDSTHGFLELFSNPSASLSYEVSDLQPYTEYM 2507

  Fly   280 TRISRLDMGAYLCIASNGVP-------PTVSKRIKVSVDFPPMLL-IPHQLVGAPEGFNVTIECF 336
            .|:          :||||..       |.::...|.....||:|| :..:::           ..
Human  2508 FRL----------VASNGFGSAHSSWIPFMTAEDKPGPVVPPILLDVKSRMM-----------LV 2551

  Fly   337 TEAHP-------TSLNYWTRGE------GPII---------HDSHKYKVEATVGLPAYKTHMKLT 379
            |..||       |..|.:..|.      |.:.         :.::|::|||........:....|
Human  2552 TWQHPRKSNGVITHYNIYLHGRLYLRTPGNVTNCTVMHLHPYTAYKFQVEACTSKGCSLSPESQT 2616

  Fly   380 IINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYSTDTHWGENGINNNYAYGGPDS 444
            :..:....:||     .:|...:|....:.:|:.|          .||  .||:..|:       
Human  2617 VWTLPGAPEGI-----PSPELFSDTPTSVIISWQP----------PTH--PNGLVENF------- 2657

  Fly   445 TRSIYAQDKNTRYQSNLNEIGLSEQKSFLDKT 476
              :|..:.|.....:.|..:..|....|:|||
Human  2658 --TIERRVKGKEEVTTLVTLPRSHSMRFIDKT 2687

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 28/122 (23%)
Ig 130..200 CDD:143165 20/85 (24%)
I-set 226..310 CDD:254352 19/99 (19%)
IGc2 233..298 CDD:197706 15/73 (21%)
Ig 313..410 CDD:299845 20/120 (17%)
IG_like 325..410 CDD:214653 16/107 (15%)
USH2ANP_996816.2 LamGL 146..283 CDD:214722
Laminin_N 295..516 CDD:295486
EGF_Lam 517..565 CDD:238012
EGF_Lam 574..639 CDD:238012
Laminin_EGF 641..691 CDD:278482
EGF_Lam 694..733 CDD:214543
Laminin_EGF 747..795 CDD:278482
EGF_Lam 794..844 CDD:238012
EGF_Lam 847..897 CDD:214543
EGF_Lam 900..948 CDD:238012
EGF_Lam 950..1000 CDD:238012
EGF_Lam 1001..>1037 CDD:238012
FN3 1060..1143 CDD:238020
FN3 1145..1238 CDD:238020
FN3 1242..1357 CDD:238020
FN3 1368..1451 CDD:214495
LamG 1519..1678 CDD:238058
LamG 1716..1868 CDD:238058
fn3 1956..2044 CDD:278470
FN3 2241..2313 CDD:238020
FN3 2329..2428 CDD:238020 22/103 (21%)
FN3 2432..2528 CDD:238020 22/109 (20%)
FN3 2533..2619 CDD:238020 16/97 (16%)
FN3 2621..2719 CDD:238020 19/94 (20%)
FN3 2724..2799 CDD:238020
FN3 2818..2920 CDD:238020
FN3 2925..3015 CDD:238020
FN3 3026..>3087 CDD:238020
FN3 <3449..3494 CDD:238020
FN3 3503..3586 CDD:238020
FN3 3590..3676 CDD:238020
FN3 3680..3767 CDD:238020
fn3 3777..3856 CDD:278470
FN3 3866..3960 CDD:238020
FN3 3964..4057 CDD:238020
FN3 4161..4247 CDD:238020
FN3 4268..4351 CDD:238020
FN3 4356..4439 CDD:238020
FN3 4444..4516 CDD:238020
FN3 4529..4627 CDD:238020
FN3 4636..4730 CDD:238020
FN3 4826..4927 CDD:238020
PDZ-binding 5200..5202
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.