DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and DIP-epsilon

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001137799.1 Gene:DIP-epsilon FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster

Alignment Length:470 Identity:278/471 (59%)
Similarity:328/471 (70%) Gaps:39/471 (8%)


  Fly    72 GGGGPVAGSGTGSTVVGSNGVIVAGGGANVPTSNL-NIVVEEPEFTEYIENVTVPAGRNVKLGCS 135
            |.|..:|.|...||..||.     |...||..|.| |::.|:||||:.|||:||||||||||.||
  Fly    15 GLGCLIASSVALSTDTGSE-----GNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACS 74

  Fly   136 VKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQI 200
            |||||||||||||||||||||||||||||||||||||||||:||||:||||||.|||||||||||
  Fly    75 VKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQI 139

  Fly   201 NTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINK 265
            ||||||||:|::.|||||||||:|:|||:|||||.|::|||:|.|||.|.|||||||.::|.|||
  Fly   140 NTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINK 204

  Fly   266 NHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFN 330
            ...|::.|.|:||:.|||||.||||||||||||||:|||||||||||.||:.|||||||.|.|||
  Fly   205 TLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFN 269

  Fly   331 VTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVA 395
            :|:|||.||:|||||||||....:|.:|.|||.|...|.|:||..|:|||.||.|.|.|.|||||
  Fly   270 ITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVA 334

  Fly   396 KNPRGETDGIIRLYVSYPPTT----ASSGIYSTDTHWGE-----------NGINNNYAYGGPDST 445
            |||||:.||.|:||:|.||||    .::.:..|.|...|           ||  |.....|...|
  Fly   335 KNPRGDMDGNIKLYMSSPPTTQPPPTTTTLRRTTTTAAEIALDGYINTPLNG--NGIGIVGEGPT 397

  Fly   446 RSIYAQDKNT-RYQSNLNEIGLSEQKSFLDKTQNPLLANGNANEAD---AESNGARGHNPSMAIA 506
            .|:.|..|:: :|.||||||..|:||          |...:....|   .:|:|:.|:  .||.:
  Fly   398 NSVIASGKSSIKYLSNLNEIDKSKQK----------LTGSSPKGFDWSKGKSSGSHGN--LMASS 450

  Fly   507 WLFVVIATLLLTIRS 521
            |..:.....|||..|
  Fly   451 WPLICCILALLTTHS 465

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 87/96 (91%)
Ig 130..200 CDD:143165 66/70 (94%)
I-set 226..310 CDD:254352 60/84 (71%)
IGc2 233..298 CDD:197706 43/65 (66%)
Ig 313..410 CDD:299845 62/97 (64%)
IG_like 325..410 CDD:214653 53/85 (62%)
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 87/96 (91%)
Ig 69..139 CDD:143165 66/70 (94%)
IG_like 165..249 CDD:214653 60/84 (71%)
IGc2 172..237 CDD:197706 43/65 (66%)
IG_like 267..348 CDD:214653 51/81 (63%)
Ig 270..339 CDD:299845 43/69 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134652713
eggNOG 1 0.900 E1_KOG3510
Homologene 1 1.000 H41139
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12231
RoundUp 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.