DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and ntm

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_021334871.1 Gene:ntm ZFINID:ZDB-GENE-060421-6020 Length:380 Species:Danio rerio

Alignment Length:389 Identity:101/390 (26%)
Similarity:177/390 (45%) Gaps:45/390 (12%)


  Fly    77 VAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGS 141
            |.|......|:|...:.:...|..|.:..     |.....:.::|:|:..|..:.|.||..:..:
Zfish     5 VCGCWRRCVVMGLRLLFLLPAGLPVRSQG-----ESQSDNKQMDNITIRQGETLFLSCSQGDFVT 64

  Fly   142 YKVAWMHFEQSAILTVHNHVITRNPRIS-VTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVT- 204
            : .||::  :|:||.......:.:||:| ||..:.:    :.:.|.:|...|.|:|:|.:.|.: 
Zfish    65 H-TAWLN--RSSILYAGEDKWSVDPRVSLVTLSQEE----FTIKIEDVDVTDEGQYICAVQTSSR 122

  Fly   205 AKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIV 269
            .:|...::.|.|||.|.:  .|.|::|.||:|::|.|.|:|.|.|.|.|:....|..:::.    
Zfish   123 PRTTSVHIIVQVPPKIVN--LSRDLVVNEGSNVTLMCLANGKPEPAIVWRMKSPSDDSLSS---- 181

  Fly   270 NEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIE 334
               :.:.|:|..|||...|.|.|.|:|.: ...::.::::|::.|.:..... ||...|....::
Zfish   182 ---DSEVLDIPFISRYRAGVYECTAANDI-AVDTQTVELTVNYAPSVSDGRD-VGVTLGQRGVLQ 241

  Fly   335 CFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPR 399
            |..:|.|.:...|.|.:..|.:.....::||...|      .:||..|||..|.|.|.|||.|..
Zfish   242 CEADAVPEADFEWYRDDRRIFNGLDGIEIEAAGAL------SRLTFFNVSEADYGNYTCVAINKL 300

  Fly   400 GETDGIIRLYVSYPPT--------TASSGIYSTDTHWGENGINNNYAYGGPDSTRSIYAQDKNT 455
            |..:....||....||        |:.|.:..|.:...:..:.|: .:.||.:     .||.|:
Zfish   301 GSANTSFVLYEIIEPTSSTLLQVETSPSVLEMTSSDLEQTPLQND-LWEGPGA-----VQDGNS 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 25/98 (26%)
Ig 130..200 CDD:143165 19/71 (27%)
I-set 226..310 CDD:254352 25/84 (30%)
IGc2 233..298 CDD:197706 22/65 (34%)
Ig 313..410 CDD:299845 28/97 (29%)
IG_like 325..410 CDD:214653 25/85 (29%)
ntmXP_021334871.1 Ig 44..132 CDD:325142 24/95 (25%)
Ig_3 135..205 CDD:316449 27/79 (34%)
I-set 228..309 CDD:333254 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80736353
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 1 1.000 T128591
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.628 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.