| Sequence 1: | NP_723441.2 | Gene: | DIP-zeta / 34231 | FlyBaseID: | FBgn0051708 | Length: | 532 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006510620.1 | Gene: | Kirrel3 / 67703 | MGIID: | 1914953 | Length: | 803 | Species: | Mus musculus |
| Alignment Length: | 461 | Identity: | 94/461 - (20%) |
|---|---|---|---|
| Similarity: | 152/461 - (32%) | Gaps: | 153/461 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 115 FTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWM-------------HFEQSAILTVHNHVITRNP 166
Fly 167 RISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIV 231
Fly 232 REGANISLRCRA-SGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITR---------ISRLD 286
Fly 287 MG--------AYLCIASN-GVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPT 342
Fly 343 SLNY-WTRGEGPIIHDS----------HKYKVE-------------------------------- 364
Fly 365 --------------ATVGLPA-------------YKTHMKLTIINVSSGDDGIYKCVAKNPR--- 399
Fly 400 GETDGIIRLYVSYPPTTASSGIYSTDTH---WGENGINNNYAYGGPDSTRSIYAQDKNTRYQSNL 461
Fly 462 NEIGLS 467 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-zeta | NP_723441.2 | IG_like | 120..216 | CDD:214653 | 22/108 (20%) |
| Ig | 130..200 | CDD:143165 | 17/82 (21%) | ||
| I-set | 226..310 | CDD:254352 | 20/102 (20%) | ||
| IGc2 | 233..298 | CDD:197706 | 18/83 (22%) | ||
| Ig | 313..410 | CDD:299845 | 31/169 (18%) | ||
| IG_like | 325..410 | CDD:214653 | 29/157 (18%) | ||
| Kirrel3 | XP_006510620.1 | IG_like | 54..143 | CDD:214653 | 21/107 (20%) |
| Ig strand A' | 56..60 | CDD:409353 | 0/3 (0%) | ||
| Ig strand B | 64..71 | CDD:409353 | 3/6 (50%) | ||
| Ig strand C | 78..82 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C' | 84..87 | CDD:409353 | 0/2 (0%) | ||
| Ig strand D | 97..101 | CDD:409353 | 1/5 (20%) | ||
| Ig strand E | 104..116 | CDD:409353 | 6/27 (22%) | ||
| Ig strand G | 132..143 | CDD:409353 | 1/10 (10%) | ||
| IgI_2_KIRREL3-like | 149..246 | CDD:409416 | 21/108 (19%) | ||
| Ig strand B | 166..170 | CDD:409416 | 1/3 (33%) | ||
| Ig strand C | 180..184 | CDD:409416 | 1/3 (33%) | ||
| Ig strand E | 210..214 | CDD:409416 | 2/3 (67%) | ||
| Ig strand F | 224..229 | CDD:409416 | 1/4 (25%) | ||
| Ig strand G | 239..242 | CDD:409416 | 0/2 (0%) | ||
| Ig | <267..334 | CDD:416386 | 12/67 (18%) | ||
| Ig strand B | 267..274 | CDD:409353 | 3/6 (50%) | ||
| Ig strand C | 279..286 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C' | 288..291 | CDD:409353 | 1/2 (50%) | ||
| Ig strand D | 298..302 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 304..310 | CDD:409353 | 1/5 (20%) | ||
| Ig strand G | 321..334 | CDD:409353 | 0/12 (0%) | ||
| Ig | 335..416 | CDD:416386 | 16/82 (20%) | ||
| Ig strand A' | 343..347 | CDD:409353 | 0/3 (0%) | ||
| Ig strand B | 350..360 | CDD:409353 | 1/9 (11%) | ||
| Ig strand C | 365..371 | CDD:409353 | 0/5 (0%) | ||
| Ig strand E | 381..387 | CDD:409353 | 2/5 (40%) | ||
| IgI_5_KIRREL3 | 418..515 | CDD:409479 | 15/59 (25%) | ||
| Ig strand B | 436..440 | CDD:409479 | 1/3 (33%) | ||
| Ig strand C | 450..454 | CDD:409479 | 1/3 (33%) | ||
| Ig strand E | 481..485 | CDD:409479 | |||
| Ig strand F | 496..501 | CDD:409479 | |||
| Ig strand G | 509..512 | CDD:409479 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||