DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Kirrel3

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_006510620.1 Gene:Kirrel3 MGIID:1914953 Length:803 Species:Mus musculus

Alignment Length:461 Identity:94/462 (20%)
Similarity:152/462 (33%) Gaps:153/462 (33%)


  Fly   115 FTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWM-------------HFEQSAILTVHNHVITRNP 166
            |::..::..|.:|:.|.|.|::.....: |.|:             .:.|  .|.|.||      
Mouse    50 FSQQPQDQVVVSGQPVTLLCAIPEYDGF-VLWIKDGLALGVGRDLSSYPQ--YLVVGNH------ 105

  Fly   167 RISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIV 231
             :|..|         :|.|.....:|...|.||......:::...|.|:|||:....|....:.:
Mouse   106 -LSGEH---------HLKILRAELQDDAVYECQAIQAAIRSRPARLTVLVPPDDPIILGGPVISL 160

  Fly   232 REGANISLRCRA-SGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITR---------ISRLD 286
            |.|..::|.|.| :..|...|.|.|         |..::|   |.|...|.         :|.|.
Mouse   161 RAGDPLNLTCHADNAKPAASIIWLR---------KGEVIN---GATYSKTLLRDGKRESIVSTLF 213

  Fly   287 MG--------AYLCIASN-GVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPT 342
            :.        :.:|.|:| .:|......:.:.:..||::.:..:.....|...||..|..:|:|.
Mouse   214 ISPGDVENGQSIVCRATNKAIPGGKETSVTIDIQHPPLVNLSVEPQPVLEDNIVTFHCSAKANPA 278

  Fly   343 SLNY-WTRGEGPIIHDS----------HKYKVE-------------------------------- 364
            ...| |.: .|.||.::          :.|..|                                
Mouse   279 VTQYRWAK-RGHIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTSEPQ 342

  Fly   365 --------------ATVGLPA-------------YKTHMKLTIINVSSGDDGIYKCVAKNPR--- 399
                          |.:|.|:             ......||:.:|...|.|.|.|.|..||   
Mouse   343 SLLVDLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGA 407

  Fly   400 GETDGIIRLYVSYPPTTASSGIYSTDTH---WGENGINNNYAYGGPDSTRSIYAQDKNTRYQSNL 461
            ||.:  :.|.|:.||.     |.||.|.   .||.|....:....|...|..::      ::.|:
Mouse   408 GERE--VTLTVNGPPI-----ISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWS------WKENV 459

  Fly   462 NEIGLS 467
            .|.|.|
Mouse   460 LESGTS 465

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 22/109 (20%)
Ig 130..200 CDD:143165 18/83 (22%)
I-set 226..310 CDD:254352 20/103 (19%)
IGc2 233..298 CDD:197706 18/84 (21%)
Ig 313..410 CDD:299845 31/170 (18%)
IG_like 325..410 CDD:214653 29/158 (18%)
Kirrel3XP_006510620.1 Ig 52..143 CDD:299845 21/110 (19%)
IG_like 54..143 CDD:214653 21/108 (19%)
IG_like 156..244 CDD:214653 20/100 (20%)
Ig2_KIRREL3-like 165..246 CDD:143236 18/93 (19%)
Ig_3 254..318 CDD:290638 13/65 (20%)
I-set 335..416 CDD:254352 16/83 (19%)
IGc2 349..400 CDD:197706 10/51 (20%)
Ig5_KIRREL3 418..515 CDD:143306 15/60 (25%)
IG_like 426..515 CDD:214653 10/47 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.