DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Tmigd1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_006534011.1 Gene:Tmigd1 MGIID:1913851 Length:294 Species:Mus musculus

Alignment Length:239 Identity:52/240 (22%)
Similarity:94/240 (39%) Gaps:64/240 (27%)


  Fly   108 IVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAW---------------MHFEQ---SAI 154
            ||.:..|.|.:.      |.|.       .||.|.|:.|               :...|   |::
Mouse    11 IVEQSTETTAFF------ASRR-------SNLHSLKMVWKITGPLQACQLLLVVLSLPQGRTSSV 62

  Fly   155 LTVH----------NHVITRNPRISVTHDKHDRHRTWY-------------LHINNV-----HEE 191
            |||:          .|.:..:...:|.:...|....||             ::|::|     :|.
Mouse    63 LTVNGRTENYILDTQHGVQASLECAVQNHTEDEELLWYREDGIVDLKNGNKINISSVCVSPINES 127

  Fly   192 DRG-RYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKR 255
            |.| |:.|::......:....|||..||.:.   .:....|.|.:::||.|....:|:..:.|.:
Mouse   128 DNGVRFTCKLQRDQTVSVTVVLNVTFPPLLS---GNGFQTVEENSDVSLVCNVKSNPQAQMMWYK 189

  Fly   256 DDNSRIAINKNHIVNEW-EGDTLEITRISRLDMGAYLCIASNGV 298
            ::::.:.....|.:::. |...|.||::.:.|.|.|.||||:.:
Mouse   190 NNSALVLEKGRHQIHQTRESFQLSITKVKKSDNGTYSCIASSSL 233

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 27/143 (19%)
Ig 130..200 CDD:143165 22/117 (19%)
I-set 226..310 CDD:254352 19/75 (25%)
IGc2 233..298 CDD:197706 18/66 (27%)
Ig 313..410 CDD:299845
IG_like 325..410 CDD:214653
Tmigd1XP_006534011.1 IG_like 163..244 CDD:214653 19/72 (26%)
Ig 171..232 CDD:143165 17/61 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.