DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and lsamp

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001034921.1 Gene:lsamp ZFINID:ZDB-GENE-090108-1 Length:333 Species:Danio rerio

Alignment Length:307 Identity:92/308 (30%)
Similarity:136/308 (44%) Gaps:36/308 (12%)


  Fly   108 IVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRIS-VT 171
            |.||....|   :|:|:..|....:.|.|.:..| ||||::  :|.|:.......:.:||:. ||
Zfish    26 ISVESQRST---DNITIRQGDTTVIRCYVDDKVS-KVAWLN--RSNIIFAGEDKWSLDPRVELVT 84

  Fly   172 HDKHDRHRTWYLHINNVHEEDRGRYMCQINT-VTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGA 235
            ..:.:    :.|.|..|...|.|.|.|.|.| ..:||...||.|.||..|  ...|.|:.|.||:
Zfish    85 QGQLE----YSLRIQKVDVFDEGPYTCSIQTKQQSKTSQVYLIVQVPAII--YKVSEDITVNEGS 143

  Fly   236 NISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPP 300
            |::|.|.|:|.|.|.|.|:..:.|..|::        .|:.|||:.:.|...|.|.|.|||.|..
Zfish   144 NVALTCLANGRPDPAITWRLLNPSAEALD--------VGEYLEISGVVRSQAGRYECKASNDVST 200

  Fly   301 TVSKRIKVSVDFPPMLLIPHQLVGAPE---GFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYK 362
            ...|.:.|.|::||.:    :.|.:.|   |....:.|...|.|.....|.|       |..:..
Zfish   201 PDVKYVNVVVNYPPYI----KDVRSSETAVGQAGVLHCEASAVPQPEFEWYR-------DERRLS 254

  Fly   363 VEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLY 409
            ...::.:....:...|.:.||:..|.|.|.|||.|..|..:..:.||
Zfish   255 SSQSLTIQVSGSRTVLVVANVTEEDYGNYTCVATNRLGVHNASVFLY 301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/98 (31%)
Ig 130..200 CDD:143165 20/71 (28%)
I-set 226..310 CDD:254352 30/84 (36%)
IGc2 233..298 CDD:197706 24/65 (37%)
Ig 313..410 CDD:299845 24/101 (24%)
IG_like 325..410 CDD:214653 21/89 (24%)
lsampNP_001034921.1 Ig 34..124 CDD:299845 30/100 (30%)
IG_like 36..124 CDD:214653 29/95 (31%)
IG_like 134..197 CDD:214653 27/71 (38%)
IGc2 141..199 CDD:197706 25/66 (38%)
I-set 213..300 CDD:254352 22/98 (22%)
Ig 231..298 CDD:143165 17/74 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.