DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and Negr1

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_067714.1 Gene:Negr1 RGDID:708416 Length:348 Species:Rattus norvegicus

Alignment Length:305 Identity:94/306 (31%)
Similarity:143/306 (47%) Gaps:29/306 (9%)


  Fly   119 IENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISV-THDKHDRHRTWY 182
            ::|:.|..|....|.|.::: |:.|.||::  :|:|:.......:.:||:|: |.:|.|    :.
  Rat    39 VDNMLVRKGDTAVLRCYLED-GASKGAWLN--RSSIIFAGGDKWSVDPRVSISTLNKRD----YS 96

  Fly   183 LHINNVHEEDRGRYMCQINTV-TAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGS 246
            |.|.||...|.|.|.|.:.|. |.:|...:|.|.|||.|.|  .|:|:.:.||.|::|.|.|:|.
  Rat    97 LQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYD--ISNDMTINEGTNVTLTCLATGK 159

  Fly   247 PRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVD 311
            |.|.|.|:     .|:.:.....|   |..|:|..|:|...|.|.|.|.|.|.....|:::|.|:
  Rat   160 PEPAISWR-----HISPSAKPFEN---GQYLDIYGITRDQAGEYECSAENDVSFPDVKKVRVVVN 216

  Fly   312 FPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHM 376
            |.|.:.........| |.:..|.|.....|.....|.:||      ...:..:..:.:..:.|..
  Rat   217 FAPTIQEIKSGTVTP-GRSGLIRCEGAGVPPPAFEWYKGE------KRLFNGQQGIIIQNFSTRS 274

  Fly   377 KLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGI 421
            .||:.||:....|.|.|||.|..|.|:..:.|   .||:||..||
  Rat   275 ILTVTNVTQEHFGNYTCVAANKLGTTNASLPL---NPPSTAQYGI 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/98 (31%)
Ig 130..200 CDD:143165 22/71 (31%)
I-set 226..310 CDD:254352 28/84 (33%)
IGc2 233..298 CDD:197706 23/65 (35%)
Ig 313..410 CDD:299845 23/97 (24%)
IG_like 325..410 CDD:214653 22/85 (26%)
Negr1NP_067714.1 Ig 38..129 CDD:299845 29/97 (30%)
IG_like 41..129 CDD:214653 29/95 (31%)
IG_like 139..215 CDD:214653 28/84 (33%)
IGc2 146..204 CDD:197706 24/66 (36%)
IG_like 225..306 CDD:214653 21/88 (24%)
Ig 237..303 CDD:143165 19/72 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80620849
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 1 1.000 T131101
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.