DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and DSCAML1

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_011541219.1 Gene:DSCAML1 / 57453 HGNCID:14656 Length:2065 Species:Homo sapiens


Alignment Length:621 Identity:136/621 - (21%)
Similarity:198/621 - (31%) Gaps:217/621 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GKHPSGSKTVATGVVPNFGGAAGNGAGGGGPVAGSGTGSTVVGSNGVIVAGGGANVPTSNLNIVV 110
            |.|.:...|::.|...:.....|.....||  ....|...:|||            ......|.|
Human   464 GSHRTNQYTMSDGTTISHMNVTGPQIRDGG--VYRCTARNLVGS------------AEYQARINV 514

  Fly   111 EEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNH--VITRN-------- 165
            ..|.....:.|:|..|||:..:.|.|.....|.:.|.   :.|:|...||  |:..|        
Human   515 RGPPSIRAMRNITAVAGRDTLINCRVIGYPYYSIKWY---KDALLLPDNHRQVVFENGTLKLTDV 576

  Fly   166 ----------------PRISVTHDKHDRHR----------------------------------T 180
                            |::|::...|...:                                  |
Human   577 QKGMDEGEYLCSVLIQPQLSISQSVHVAVKVPPLIQPFEFPPASIGQLLYIPCVVSSGDMPIRIT 641

  Fly   181 W----------------------YLHINNVHEEDRGRYMCQIN----TVTAKTQFGYLNVVVPPN 219
            |                      .|.|::|..:..|.|.|..:    ||:.:.|   |.|.|||.
Human   642 WRKDGQVIISGSGVTIESKEFMSSLQISSVSLKHNGNYTCIASNAAATVSRERQ---LIVRVPPR 703

  Fly   220 IDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDNS-------------RIAINKNHIVNE 271
            .....::.|.|.  |....|.|...|.|.|.:.||....|             ||.|..|     
Human   704 FVVQPNNQDGIY--GKAGVLNCSVDGYPPPKVMWKHAKGSGNPQQYHPVPLTGRIQILPN----- 761

  Fly   272 WEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECF 336
               .:|.|..:...|:|.|||.|||||...:||.:.::|..|.|      :...|   |.||.  
Human   762 ---SSLLIRHVLEEDIGYYLCQASNGVGTDISKSMFLTVKIPAM------ITSHP---NTTIA-- 812

  Fly   337 TEAHPTSLNYWTRGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGI----------- 390
            .:.|...||...|||.|||   .:::...||..|  ...|:..|....:||:.:           
Human   813 IKGHAKELNCTARGERPII---IRWEKGDTVIDP--DRVMRYAIATKDNGDEVVSTLKLKPADRG 872

  Fly   391 ----YKCVAKNPRGETDGIIRLYVSYPPTTASSGI-----YSTDTHWGE----NGI--------- 433
                :.|.|.|..||..|:|:|.|..||......|     .|.:..|.:    |.|         
Human   873 DSVFFSCHAINSYGEDRGLIQLTVQEPPDPPELEIREVKARSMNLRWTQRFDGNSIITGFDIEYK 937

  Fly   434 NNNYAYGGPDSTRSIYAQDKNTRYQSNL----------------NEIGLSEQKSFL--------- 473
            |.:.::....|||:|    ..|..|:|:                |:||.||....|         
Human   938 NKSDSWDFKQSTRNI----SPTINQANIVDLHPASVYSIRMYSFNKIGRSEPSKELTISTEEAAP 998

  Fly   474 -----DKTQNPLLANG-----NANEADAESNGARGH 499
                 |.|..|:.:..     .|.:.:.::...||:
Human   999 DGPPMDVTLQPVTSQSIQVTWKAPKKELQNGVIRGY 1034

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 31/181 (17%)
Ig 130..200 CDD:143165 21/151 (14%)
I-set 226..310 CDD:254352 29/96 (30%)
IGc2 233..298 CDD:197706 23/77 (30%)
Ig 313..410 CDD:299845 30/111 (27%)
IG_like 325..410 CDD:214653 28/99 (28%)
DSCAML1XP_011541219.1 IG_like 43..119 CDD:214653
IGc2 43..110 CDD:197706
Ig 125..218 CDD:299845
IG_like 137..209 CDD:214653
I-set 245..323 CDD:254352
IGc2 252..313 CDD:197706
IGc2 340..401 CDD:197706
I-set 420..514 CDD:254352 12/63 (19%)
Ig 420..510 CDD:299845 11/59 (19%)
IGc2 531..589 CDD:197706 12/60 (20%)
IG_like 619..698 CDD:214653 12/81 (15%)
Ig 627..693 CDD:143165 10/65 (15%)
I-set 702..797 CDD:254352 30/104 (29%)
Ig7_DSCAM 719..797 CDD:143211 26/85 (31%)
I-set 803..896 CDD:254352 28/102 (27%)
Ig 815..903 CDD:299845 27/92 (29%)
FN3 899..993 CDD:238020 21/97 (22%)
FN3 1000..1097 CDD:238020 6/35 (17%)
fn3 1105..1191 CDD:278470
FN3 1203..1294 CDD:238020
IGc2 1318..1382 CDD:197706
FN3 1396..1486 CDD:238020
FN3 1500..1572 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.