DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and DIP-delta

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster

Alignment Length:454 Identity:195/455 (43%)
Similarity:267/455 (59%) Gaps:44/455 (10%)


  Fly   104 SNL--NIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNP 166
            :||  :::::||.|.:.|.||||..||:..|.|.|::||.|||||:|.::..|||:|.|||:|.|
  Fly    33 TNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIP 97

  Fly   167 RISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSS-SDVI 230
            |.|:|:..:    ||.||:|..|::|||.||||:||....:|.|||.|||||||.|..|: |.|.
  Fly    98 RYSITYTDN----TWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVA 158

  Fly   231 VREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIAS 295
            |||..||::.|||.|.|.|.|.|:|:|...||:.|...|..::.|.|.:|::||.:||||||||:
  Fly   159 VRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIAT 223

  Fly   296 NGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHK 360
            |||||:|||||.:.|:|.||:.:|:||||||.|.:|||:|.|||||.::.||......:: .|.|
  Fly   224 NGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVL-PSKK 287

  Fly   361 YKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYSTD 425
            ||.:.|..  :|:.||||||.|:..||.|.|:|::||..|||:|.||:|....|:|.|..:..|.
  Fly   288 YKTDYTEN--SYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSKQVTHTT 350

  Fly   426 THWGENGI---NNNYAYGGPDSTRSI-----YAQDKNTRY---QSNLNEIGLSEQKSFLDKTQNP 479
            ....||.|   :.|      |:|:|:     ||. ||..|   .|:.:..|.|...|.....|..
  Fly   351 VESRENNIIPSSRN------DTTKSLQTDVGYAM-KNDLYPGSASSSSSGGSSSAASSSSSMQTS 408

  Fly   480 LLANGNANEADAESNGARGHNPSMAIA------------WLFVVIATLLLTIRSAVGSSHSLSL 531
            .|..|.|..: ..|.|::|   |:||.            :....:|.|||......||...|:|
  Fly   409 ALPGGVAGNS-LSSMGSKG---SLAIGKSTFYTERPPNEYAASSVAGLLLHRALLFGSGIYLTL 468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 50/96 (52%)
Ig 130..200 CDD:143165 36/70 (51%)
I-set 226..310 CDD:254352 44/85 (52%)
IGc2 233..298 CDD:197706 32/65 (49%)
Ig 313..410 CDD:299845 48/97 (49%)
IG_like 325..410 CDD:214653 41/85 (48%)
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 50/96 (52%)
Ig 53..143 CDD:299845 49/94 (52%)
Ig 144..224 CDD:299845 40/80 (50%)
I-set 150..238 CDD:254352 45/88 (51%)
I-set 242..333 CDD:254352 47/94 (50%)
Ig 259..332 CDD:143165 36/76 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I2478
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D265311at33208
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12231
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.