DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and CG34353

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster

Alignment Length:463 Identity:111/464 (24%)
Similarity:182/464 (39%) Gaps:104/464 (22%)


  Fly   112 EPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHD 176
            ||.|....|......|..:.|.|.|.|..:|.|||.  ...||||..:..:|.:||:.:.:.   
  Fly    85 EPMFISRSETFKFITGETIVLPCEVANTDTYVVAWK--RGIAILTAGSVKVTPDPRVRLVNG--- 144

  Fly   177 RHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLRC 241
                :.|.|.:....|.|.|:|||.|:..:.....:.::|||.|....:...:.|::|:::.:.|
  Fly   145 ----FNLQIRDALPTDAGDYICQIATMDPREITHTVEILVPPRIHHISTGGHLQVKKGSSVRIEC 205

  Fly   242 RASGSPRPIIKWKRDDNSRIAINKNHIVNEWE----GDTLEITRISRLDMGAYLCIASNGVPPTV 302
            .|:|:|.|.:.|.|         ||:|:...|    ...|.|..:.|...|.|:|.|:|.|....
  Fly   206 SATGNPMPNVTWSR---------KNNILPNGEEKLHSHVLSIENVDRHKGGVYICTANNRVGQPA 261

  Fly   303 SKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHKYKV---E 364
            |.::.:.|.|.|.:.:...:|.:.||...|:.|                  |:|...:.:|   :
  Fly   262 SSQVVLHVLFSPEISVERPVVFSGEGHEATLVC------------------IVHGETQPEVIWFK 308

  Fly   365 ATVGLPAYKTHM--------KLTIINVSSGDDGIYKCVAKNPRGETDGIIRL-------YVSYPP 414
            .|:.|...:.|:        .|.|..|...|.|.|.|||:|..|:....::|       ..:.||
  Fly   309 DTMQLDTTERHIMETRGSRHTLIIRKVHPQDFGNYSCVAENQLGKARKTLQLSGKPNVAVFNSPP 373

  Fly   415 TTASSGIY----STDTH--------------WGE----NGINNNYAYGGPDSTRS-IYAQDKNT- 455
            .:.....|    :.|:|              .|.    |.|:::.:.....|:.| :|....:. 
  Fly   374 ISQYKDRYNISWAVDSHSPIEEYKLSFRKLPQGHEVVGNAIDSSSSSSSMSSSSSQMYGSGLHAH 438

  Fly   456 RYQSNLNEI-GLSEQKSFLDKTQNPLLANGNANEADAESNGARGHNPSMAIAWLFVVIATLLLTI 519
            |..||:..: |||...|:          :|..|...      .|||.     |..||:..:.::.
  Fly   439 RIGSNMGGLSGLSGSGSY----------SGYGNVIH------WGHND-----WRNVVLPAVPVSH 482

  Fly   520 RSAVGSSH 527
            ..|.|.|:
  Fly   483 HYAQGMSY 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 26/96 (27%)
Ig 130..200 CDD:143165 22/70 (31%)
I-set 226..310 CDD:254352 23/88 (26%)
IGc2 233..298 CDD:197706 20/69 (29%)
Ig 313..410 CDD:299845 24/115 (21%)
IG_like 325..410 CDD:214653 22/103 (21%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 25/89 (28%)
Ig 103..177 CDD:143165 24/83 (29%)
IG_like 191..269 CDD:214653 23/87 (26%)
IGc2 198..258 CDD:197706 21/69 (30%)
I-set 273..360 CDD:254352 23/105 (22%)
Ig 290..359 CDD:143165 19/87 (22%)
FN3 <466..524 CDD:238020 9/31 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.