DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and kirrel3a

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_700618.5 Gene:kirrel3a ZFINID:ZDB-GENE-091117-44 Length:774 Species:Danio rerio

Alignment Length:416 Identity:100/417 (24%)
Similarity:152/417 (36%) Gaps:127/417 (30%)


  Fly   115 FTEYIENVTVPAGRNVKLGCSVKNLGSYK--VAWMHFEQSAILTVHNHVITRNPRISV--THDKH 175
            |.:...::.:.||..|.|.|::  :| |:  |.|:  :....|.| |..::..||..|  .|.|.
Zfish    23 FIQQPHDLVIVAGEPVTLPCTI--IG-YQGMVLWV--KDGLALGV-NRDLSGYPRYDVIGDHSKG 81

  Fly   176 DRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSSSDVIVREGANISLR 240
            :.|    |.|......|.|.:.||...|..:::...|.|:|||:....:.:..|.:|.|.:::|.
Zfish    82 EYH----LLIERTELVDDGSFECQAIQVAGRSRPAQLTVLVPPDDPVIIGAPVVSLRAGDSLNLT 142

  Fly   241 CRASGS-PRPIIKWKRDDNSRIAINKNHIVN--------------EWEGDTLEITRISRLDMGAY 290
            |.|:.: |...|.|         |....::|              |....||.|: .|.::.|..
Zfish   143 CHANNAKPAASIIW---------IRNGEVINGAAYTKTLLRDGKRESTVSTLHIS-ASNIESGQQ 197

  Fly   291 L-CIASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGAP--EGFNVTIECFTEAHPTSLNY-WTRGE 351
            : |.|||...|. .|...|::|.....|:...:...|  ||..|...|..:|:|...:| |.:| 
Zfish   198 ITCRASNKAAPN-GKEATVTIDIQHFPLVNLSVEPQPVLEGNLVKFHCAAKANPPVTHYRWAKG- 260

  Fly   352 GPIIHDS----------HKYKVE------------------------------------------ 364
            |.:|.|:          |.:..|                                          
Zfish   261 GSMITDATGDTYEVLVDHSFFTEPVSCEVTNALGSTNISRNVDVYFGPRLAAEPQSLQVDRGSDA 325

  Fly   365 ----ATVGLPAYK-THMK------------LTIINVSSGDDGIYKCVAKNPR---GETDGIIRLY 409
                |.:|.|:.. ..||            ||:..|...|.|.|.|.|..||   ||.:  :.|.
Zfish   326 VFSCAWIGNPSLTIVWMKRGHGVVLSNENTLTLKAVRQEDAGKYVCRAVVPRVGVGEKE--VMLT 388

  Fly   410 VSYPPTTASSGIYSTDTH---WGENG 432
            |:.||:     |.||.|.   :||.|
Zfish   389 VNGPPS-----ISSTQTQQALYGEKG 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 27/100 (27%)
Ig 130..200 CDD:143165 22/74 (30%)
I-set 226..310 CDD:254352 24/100 (24%)
IGc2 233..298 CDD:197706 19/81 (23%)
Ig 313..410 CDD:299845 34/172 (20%)
IG_like 325..410 CDD:214653 33/160 (21%)
kirrel3aXP_700618.5 Ig 25..116 CDD:299845 26/101 (26%)
IG_like 27..116 CDD:214653 26/99 (26%)
I-set 123..217 CDD:254352 24/105 (23%)
Ig2_KIRREL3-like 139..219 CDD:143236 22/91 (24%)
Ig_2 227..304 CDD:290606 15/78 (19%)
I-set 308..389 CDD:254352 18/83 (22%)
IGc2 322..373 CDD:197706 12/51 (24%)
Ig5_KIRREL3 391..488 CDD:143306 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.