DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and igsf9bb

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_009293693.1 Gene:igsf9bb ZFINID:ZDB-GENE-091112-15 Length:1439 Species:Danio rerio

Alignment Length:400 Identity:105/400 (26%)
Similarity:154/400 (39%) Gaps:109/400 (27%)


  Fly    80 SGTGSTVVGSNGVIVAGGGANVPTSNLNIVVEEPEFTEYIENVTVPAGRNVKLGCSV---KNLGS 141
            |..|:...|::|                 |.|||:|      ||..||..|.|||.|   .|...
Zfish    14 STRGTAAQGAHG-----------------VREEPQF------VTSRAGETVILGCDVVHPLNGQP 55

  Fly   142 YKVAWMHFEQSAILTVH-----NHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQIN 201
            |.|.|..|.......::     .||   :|..:.....|.:..   |.|..|..||:|.|.|:: 
Zfish    56 YVVEWFKFGVPIPFFINFRFYPPHV---DPEYAGRASLHGKSS---LRIERVRSEDQGWYECKV- 113

  Fly   202 TVTAKTQFG--------YLNVVVPPNIDDSLSSSDVIVREGANISLRCRASGSPRPIIKWKRDDN 258
             :..:.|:.        :|.|..||...|: ....|..:||.:|:|.|.|.|:|:|.:.|.|:.|
Zfish   114 -LMLEQQYHTFHNGSWVHLTVNAPPTFTDT-PPQYVEAKEGGSITLSCTAFGNPKPSVSWLREGN 176

  Fly   259 SRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIASNGVPPTVSKRIKVSVDFPPMLLIPHQLV 323
            . :..:..:.|::   .:|.:..|||.|.|||.|.|.:.....| ...::.|..||.::.|    
Zfish   177 P-VQDSTKYKVSD---GSLTLVSISREDRGAYTCRAYSEQGEAV-HTTRLLVQGPPFIVSP---- 232

  Fly   324 GAPEGFNVTIE------CFTEAHPTSLNY---WTRG----------------EGPII------HD 357
              ||...|.|.      |..||:|.:|.|   |...                :|.:|      .|
Zfish   233 --PENITVNISQDAFFTCQAEAYPGNLTYTWFWEEDNVFFKNDLKRRVSILIDGSLIISQVKPED 295

  Fly   358 SHKYKVEA--TVGLP----AYKT-HMKLTIIN------VSSGDDGIYKC-VAKNP-----RGETD 403
            :.||....  ::|.|    ||.| |....:||      |:.|..|..:| |..||     :.:.|
Zfish   296 AGKYTCSPSNSLGRPPSASAYLTVHYPARVINMPPVIYVAIGLPGYIRCPVDANPPVTSVKWKKD 360

  Fly   404 GIIRLYVSYP 413
            |:......||
Zfish   361 GLPLRIEKYP 370

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 29/112 (26%)
Ig 130..200 CDD:143165 22/78 (28%)
I-set 226..310 CDD:254352 25/84 (30%)
IGc2 233..298 CDD:197706 23/65 (35%)
Ig 313..410 CDD:299845 36/147 (24%)
IG_like 325..410 CDD:214653 33/135 (24%)
igsf9bbXP_009293693.1 IG_like 30..113 CDD:214653 28/95 (29%)
Ig 41..113 CDD:143165 22/78 (28%)
IG_like 144..223 CDD:214653 25/84 (30%)
IGc2 151..208 CDD:197706 22/61 (36%)
I-set 227..319 CDD:254352 23/98 (23%)
Ig <263..319 CDD:299845 11/56 (20%)
Ig_2 326..414 CDD:290606 13/45 (29%)
IG_like 329..403 CDD:214653 11/42 (26%)
IG_like 424..504 CDD:214653
Ig 440..504 CDD:299845
FN3 509..604 CDD:238020
FN3 620..704 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.