DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and ush2a

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_009291422.1 Gene:ush2a ZFINID:ZDB-GENE-060503-794 Length:5243 Species:Danio rerio

Alignment Length:502 Identity:106/503 (21%)
Similarity:158/503 (31%) Gaps:170/503 (34%)


  Fly    35 GGGGGGVGTAQGKHPSGSKTVATGVVPNFGGAAGNGAGGGGPV---AGSGTGSTVVGSNGVIVAG 96
            ||...||     .||:.:|   ..::..|||...:.....|||   |...:.:..|..:|.:.|.
Zfish  1861 GGVPPGV-----THPALNK---HSLLHGFGGCIRDVRLARGPVVSLAAVSSSAVRVNLDGCLSAD 1917

  Fly    97 GGANVPTSNLNIVVE------------EPEFTEYIENV--------------------TVPAGRN 129
            ...|. ..|.:|:|.            :| ||||:..|                    |||....
Zfish  1918 TSVNC-RGNDSILVYTGRDRSAEDLTLQP-FTEYLYRVMASGEGGWIGGPWQRGRSRETVPQSVL 1980

  Fly   130 VKLGCSVKNLGSYKVAWMHFEQSAIL--TVHNHVITRNPR-------ISVTHDKHDRHRTWYLHI 185
            ........|..|.:|:|   |:.|.:  .:..:|:....|       ||.|. .|.:|.|..|  
Zfish  1981 PPSRVGSVNGSSVEVSW---EEPAEVRGVIEKYVLKAYSRDRPSSSPISATF-PHSQHLTGTL-- 2039

  Fly   186 NNVHEEDRGRYMCQINTVTAKTQFGY--------LNV------VVPPNIDDSLSSSDVIVREGAN 236
                 .....:.....|:||.||.|.        .|.      .|||....|..:          
Zfish  2040 -----SGLAPFSSYSITLTACTQAGCSESPFATGFNTPQEAPEEVPPPAAVSYPN---------- 2089

  Fly   237 ISLRCRASGSPRP---IIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYL------- 291
             ||....:..|:|   ||::       |....|.::......:..||     |:|.:.       
Zfish  2090 -SLSVHWNHPPKPNGIIIQY-------ILYKNNTVLYRGNSTSFNIT-----DVGVFTPHKLLLS 2141

  Fly   292 ------CIASNGV-------PPTVSKRIKVSVDFPPMLLI-----PHQLVGAPEGFNVTIECFTE 338
                  |..|..|       |||..:        ||:|.:     .|....||...|..:|.:| 
Zfish  2142 ACTEAGCTNSTQVTLFTGQLPPTYVE--------PPILTVLDARSIHIQWAAPVEVNGLLEFYT- 2197

  Fly   339 AHPTSLNYWTRGEGP-IIHDSHKYKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGET 402
                 |:.|..||.| |:::|.             :.....|:.|:..|...:::..|....|.|
Zfish  2198 -----LHQWALGEEPLIVYNSS-------------ELFQDYTVRNLVPGSTYLFQIAACTGGGCT 2244

  Fly   403 ---DGIIRLYVSYPPTTASSGIYSTDTH-----W----GENGINNNY 437
               ....|...|.|....:..|.|...|     |    ..||:.::|
Zfish  2245 LSDPSTARTEESSPEEVPAPNILSLSPHSLHLSWTPPRKPNGVISSY 2291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 26/139 (19%)
Ig 130..200 CDD:143165 15/79 (19%)
I-set 226..310 CDD:254352 18/107 (17%)
IGc2 233..298 CDD:197706 14/81 (17%)
Ig 313..410 CDD:299845 23/106 (22%)
IG_like 325..410 CDD:214653 19/89 (21%)
ush2aXP_009291422.1 Laminin_G_3 160..297 CDD:290121
Laminin_N 307..528 CDD:295486
EGF_Lam 529..577 CDD:238012
EGF_Lam 586..638 CDD:238012
Laminin_EGF 653..703 CDD:278482
Laminin_EGF 706..756 CDD:278482
EGF_Lam 759..797 CDD:214543
Laminin_EGF 808..857 CDD:278482
EGF_Lam 859..912 CDD:238012
EGF_Lam 913..963 CDD:238012
EGF_Lam 965..1014 CDD:238012
EGF_Lam 1015..1064 CDD:238012
FN3 1177..1253 CDD:238020
FN3 1264..1375 CDD:238020
FN3 1386..1469 CDD:214495
LamG 1537..1699 CDD:238058
LamG 1737..1890 CDD:238058 10/37 (27%)
FN3 1981..2071 CDD:238020 22/101 (22%)
FN3 2163..2253 CDD:238020 25/117 (21%)
FN3 2258..2341 CDD:238020 8/35 (23%)
FN3 2352..2443 CDD:238020
FN3 2447..2544 CDD:238020
FN3 2547..2633 CDD:238020
FN3 2635..2733 CDD:238020
FN3 2743..2807 CDD:238020
FN3 2830..2932 CDD:238020
fn3 2939..3014 CDD:278470
FN3 3032..>3099 CDD:238020
FN3 3542..3611 CDD:238020
FN3 3615..3701 CDD:238020
fn3 3718..3784 CDD:278470
FN3 3801..3887 CDD:238020
FN3 3908..3971 CDD:238020
FN3 3996..4086 CDD:238020
FN3 4186..4284 CDD:238020
fn3 4288..4366 CDD:278470
FN3 4382..4465 CDD:238020
FN3 4470..4553 CDD:238020
FN3 4555..4653 CDD:238020
FN3 4679..4753 CDD:238020
fn3 4760..4830 CDD:278470
FN3 4864..4955 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.