DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DIP-zeta and dscama

Sequence 1:NP_723441.2 Gene:DIP-zeta FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:XP_021334866.1 Gene:dscama ZFINID:ZDB-GENE-050310-7 Length:2025 Species:Danio rerio

Alignment Length:518 Identity:124/519 (24%)
Similarity:181/519 (35%) Gaps:137/519 (26%)


  Fly   105 NLNIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGS--YKVAWMHFEQSAILTVHNHVITRNPR 167
            ::::.|:.|.|.:..|......|..|.:.|.|:: |.  ..:.|....:|.           |..
Zfish   589 SVHVTVKVPPFIQPFEFPRYSIGHRVFVPCVVRS-GDLPISITWEKDGKSI-----------NAS 641

  Fly   168 ISVTHDKHDRHRTWYLHINNVHEEDRGRYMC--QINTVTAKTQFGYLNVVVPPNIDDSLSSSDVI 230
            :.||.|..|  .|..|.|:|:.....|.|.|  |.:....|.| ..|.|.|||.........|.|
Zfish   642 LGVTIDNID--FTSSLRISNLQRVHNGTYTCIAQNDAAVVKYQ-SQLIVRVPPRFKVQPQDQDGI 703

  Fly   231 VREGANISLRCRASGSPRPIIKWKRDDNS------RIAINKNHIVNEWEGDTLEITRISRLDMGA 289
            .  |.::.|.|.|.|.|||.|:||....:      .||:|....|......:|.|..:...|.|.
Zfish   704 Y--GKSVILNCSADGEPRPTIEWKYSKGAGVPQFQPIALNSGFRVQLLGNGSLLIKHVLEEDAGY 766

  Fly   290 YLCIASNGVPPTVSKRIKVSVDFPPMLL-IPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGP 353
            |||..||.|...|||.:.::|..|.|:. .|:..: |.:|..:.:.|  :||         ||.|
Zfish   767 YLCKVSNDVGADVSKSMYLNVKIPAMITSYPNNSL-ATKGEKIEMSC--KAH---------GEKP 819

  Fly   354 IIHDSHKYKVEATVGLPAYKTHM--------KLTIINVSS-------------GDDGIYKCVAKN 397
            |:....| :||     ...::||        .:|:.||..             .|.|.:.|.|.|
Zfish   820 IMVRWEK-EVE-----KEKQSHMINPDMWRHTVTVKNVGDEVVSTLQIYPTMREDSGFFSCHAIN 878

  Fly   398 PRGETDGIIRLYVSYPPTTASSGIYSTD-----THWGENGINNNYAYGGPD----STRSIYAQDK 453
            ..||..||::|.|..||......|....     ..| ..|.:.|....|.|    :....:.:.:
Zfish   879 SYGEDRGILQLTVQEPPEPPKVEIREVKERTIALRW-TMGFDGNSLITGYDIECKNKTETWERAR 942

  Fly   454 NTR-------------------YQSNL---NEIGLSEQKSFLDKTQNPLLANGNANEADAESNGA 496
            .||                   |...:   |.||.||..:.|..|.:.....|...:...|:..:
Zfish   943 RTRDVSPTLNQATIIELHPSSTYNIRMFAKNHIGDSEPSNELTVTTDEADPEGPPQDVTLEAITS 1007

  Fly   497 RGHNPSMAIAW----------------------------LFVVIATLLLTIRSAVGSSHSLSL 531
            :    |:.:.|                            .||.|:.      .|.|.:.||||
Zfish  1008 Q----SIKVTWKAPLKHLQNGVIRGYQVCHREHSTNGSHQFVCISV------EATGETESLSL 1060

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 25/100 (25%)
Ig 130..200 CDD:143165 19/74 (26%)
I-set 226..310 CDD:254352 30/90 (33%)
IGc2 233..298 CDD:197706 24/71 (34%)
Ig 313..410 CDD:299845 30/119 (25%)
IG_like 325..410 CDD:214653 27/106 (25%)
dscamaXP_021334866.1 Ig 124..217 CDD:325142
I-set 236..311 CDD:254352
IG_like 321..402 CDD:214653
I-set 408..502 CDD:333254
IGc2 524..579 CDD:197706
Ig 614..679 CDD:319273 19/79 (24%)
Ig_DSCAM 708..787 CDD:143211 27/79 (34%)
Ig 805..898 CDD:325142 29/110 (26%)
FN3 894..988 CDD:238020 18/95 (19%)
FN3 995..1092 CDD:238020 13/77 (17%)
fn3 1100..1186 CDD:306538
fn3 1199..1282 CDD:306538
Ig 1312..1377 CDD:319273
fn3 1405..1471 CDD:306538
FN3 1492..1563 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.